DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and Muc96D

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_733106.2 Gene:Muc96D / 318737 FlyBaseID:FBgn0051439 Length:881 Species:Drosophila melanogaster


Alignment Length:34 Identity:11/34 - (32%)
Similarity:16/34 - (47%) Gaps:4/34 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PANKLVLGVGTY-GRSFQLSDSSQNWPGAPCRGE 272
            |.|:|:..|..: |.|   |.||:......|.|:
  Fly   800 PVNRLLWEVAEWAGLS---SSSSEAQLKVSCLGK 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 11/34 (32%)
Glyco_18 23..346 CDD:214753 11/34 (32%)
Muc96DNP_733106.2 ChtBD2 29..72 CDD:214696
CBM_14 827..875 CDD:279884 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.