powered by:
Protein Alignment Cht9 and Muc96D
DIOPT Version :9
Sequence 1: | NP_611543.3 |
Gene: | Cht9 / 37392 |
FlyBaseID: | FBgn0034582 |
Length: | 368 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_733106.2 |
Gene: | Muc96D / 318737 |
FlyBaseID: | FBgn0051439 |
Length: | 881 |
Species: | Drosophila melanogaster |
Alignment Length: | 34 |
Identity: | 11/34 - (32%) |
Similarity: | 16/34 - (47%) |
Gaps: | 4/34 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 240 PANKLVLGVGTY-GRSFQLSDSSQNWPGAPCRGE 272
|.|:|:..|..: |.| |.||:......|.|:
Fly 800 PVNRLLWEVAEWAGLS---SSSSEAQLKVSCLGK 830
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3325 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.