DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and lmd-5

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001309512.1 Gene:lmd-5 / 187942 WormBaseID:WBGene00020141 Length:1518 Species:Caenorhabditis elegans


Alignment Length:443 Identity:118/443 - (26%)
Similarity:193/443 - (43%) Gaps:122/443 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVLCLSQVIGAERIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGINDNGEIQ----SL 69
            |..|..:::|              |.:|.|:.:::.......||:.::|..:..:|.::    |.
 Worm   985 AASCGKRIVG--------------YYTGWGEREITENQLKKLTHVIFAFVAMYADGSVKFGPVSA 1035

  Fly    70 DTWLDYDLG----------FINQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFIN 124
            |     |.|          |::.....:..||.::||..|||| :.|..:||::.|..||:||::
 Worm  1036 D-----DPGPQAGKKAERRFVDMKKKARAVNSGVRVLFAVGGW-DNSQYFSSVAADSGKRRNFVD 1094

  Fly   125 SALNLLRNHGFDGLDLDWEYPNQRGGNWNDRANFVTLLREIKEAFAPYG--------YELGIAVG 181
            |..:.:.:|..||:|||||||..:||   |:.|.|||:||::|.|....        |.:.:|..
 Worm  1095 SVASFIEHHKIDGVDLDWEYPEMKGG---DKQNHVTLIRELRERFNGMASRNNRKDPYLITLASA 1156

  Fly   182 AGESLASASYEIANIAQQVDFINVMTYDFAMASDGQ----TGFNAPQW-----------AVENAI 231
            |||......|::..|....|||||||||:..|.:.:    ||..||.:           ..:.::
 Worm  1157 AGEWNLREGYDLKGILNYADFINVMTYDYYGAWESKWGAYTGTPAPLYFGSLKGFSGKLNADFSM 1221

  Fly   232 NFWLSQGAPANKLVLGVGTYGRSF----QLSDSSQN-W-PGAPCRGEGSAGSYTGSTGYLGYNEI 290
            .|:.......::|.:||..|||.:    :..|:|.| | ..||     ..|.|.|  ||:|:..:
 Worm  1222 KFYACNTKKPSQLTMGVPFYGRYWKNVLEPIDASDNMWRTAAP-----QNGKYEG--GYVGWRNL 1279

  Fly   291 CQNNWH---TVFDYDNAAPYAYSGD--QWVSFDNVLSVQYKMDFALSKGLAGAMIWSLETDD--- 347
            .:..|:   ..:......||..:..  .::.|:|..|::.|||:|.::.|.|.|||:|:.||   
 Worm  1280 EKEGWNKGSATWHKKTKTPYIMNNGARMFLGFENERSLKEKMDYATNRNLGGLMIWALDLDDDAD 1344

  Fly   348 ---------------------YR--------------------GQCGETYPLL 359
                                 |:                    ||||::.||:
 Worm  1345 TLLNLVSSAGLCSGGSGDKITYKCVPIDDVRWWTPENSDENRQGQCGKSAPLI 1397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 115/429 (27%)
Glyco_18 23..346 CDD:214753 106/370 (29%)
lmd-5NP_001309512.1 LysM 22..65 CDD:197609
LysM 77..120 CDD:197609
LysM 151..194 CDD:197609
LysM 220..260 CDD:197609
LysM 275..312 CDD:197609
LysM 386..429 CDD:197609
Self-incomp_S1 851..944 CDD:283566
Glyco_18 991..1336 CDD:214753 105/374 (28%)
GH18_chitinase-like 992..1336 CDD:299167 105/373 (28%)
ChtBD1_GH18_2 1388..1435 CDD:211315 6/10 (60%)
ChtBD1_GH18_2 1462..1513 CDD:211315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164293
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.