DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and chil-17

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_496019.1 Gene:chil-17 / 187733 WormBaseID:WBGene00011159 Length:435 Species:Caenorhabditis elegans


Alignment Length:374 Identity:86/374 - (22%)
Similarity:152/374 - (40%) Gaps:75/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCLSQVIGAERIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGINDNGEIQSLDTWLDY 75
            :|..:::|              |.|.....|:|.......||..::|..|..:|.:|..:  |..
 Worm    73 ICKRRIVG--------------YYSEYDSTDISKNQLAKLTHAVFAFVDIKYDGTLQFKN--LIT 121

  Fly    76 DLGFINQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNHGFDGLDL 140
            :..|.:.....::.:||||::..:|| :|.|..:||...:...:...|.|.:..:.:|..||:||
 Worm   122 EQKFFSLKSKARSLHSNLKLMFSIGG-DENSFDFSSALANTQMKSTLITSIIAFIHSHMIDGVDL 185

  Fly   141 DWEYPNQRGGNWNDRANFVTLLREIKEAFAPYGYELGIAV---GAGESLASASYEIANIAQQVDF 202
            .|::|..|     |::|:.||:|||:|.......::.|::   ..|.|...:.:::..|.:.|||
 Worm   186 HWKWPTSR-----DKSNYATLIREIREKVDELDAKIIISITIPPVGVSDWESGFDLDAIQKHVDF 245

  Fly   203 INVMTYDFAMASDGQTG----------FNA-------PQWAVEN-------------AINFWLSQ 237
            |||.:.|:|.....|.|          ||.       ..|.:::             .|.|::..
 Worm   246 INVHSMDYAKPLPNQWGTPTGPSASMNFNIGLRQHYNVDWTMKHYTCELKKPSMINLVIPFYVRM 310

  Fly   238 GAPANKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSYTGSTGYLGYNEICQNNWHTVFDYD 302
            .....|.:.......|:.:|.|:.       ..|......||.....:   |:...:|      |
 Worm   311 WKNVQKAIDNRTEVFRNVELKDNE-------VEGRSQLSRYTVEHEDM---ELSPESW------D 359

  Fly   303 NAAPYAYSGD----QWVSFDNVLSVQYKMDFALSKGLAGAMIWSLETDD 347
            ||....|..|    .:.:::|..|::.|:|:.....|.|..|||::.||
 Worm   360 NATQTPYVLDLKTRTFFTYENEKSIKVKLDYVNKMDLGGVWIWSVDMDD 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 84/362 (23%)
Glyco_18 23..346 CDD:214753 82/359 (23%)
chil-17NP_496019.1 Glyco_18 77..407 CDD:214753 83/367 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164307
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.