Sequence 1: | NP_611543.3 | Gene: | Cht9 / 37392 | FlyBaseID: | FBgn0034582 | Length: | 368 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001263897.1 | Gene: | K08F9.3 / 187168 | WormBaseID: | WBGene00010686 | Length: | 287 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 41/202 - (20%) |
---|---|---|---|
Similarity: | 79/202 - (39%) | Gaps: | 49/202 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 CLSQVIGAERIVNCYWGTWANYRSG-NGKFDVSNIDAGLCTHLSYSFFGINDNGEIQSLDTWLDY 75
Fly 76 DLGFINQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNHGFDGLDL 140
Fly 141 DWEYPNQRGGNWNDRANFVTLL---REIKEAFAPYGYELGIAVGAGESLASASYEIANIAQQVDF 202
Fly 203 INVMTYD 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cht9 | NP_611543.3 | GH18_chitolectin_chitotriosidase | 23..366 | CDD:119351 | 37/191 (19%) |
Glyco_18 | 23..346 | CDD:214753 | 37/191 (19%) | ||
K08F9.3 | NP_001263897.1 | Glyco_hydro_18 | 122..>272 | CDD:279094 | 38/194 (20%) |
GH18_chitinase-like | 124..276 | CDD:299167 | 38/196 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |