DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and K08F9.3

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001263897.1 Gene:K08F9.3 / 187168 WormBaseID:WBGene00010686 Length:287 Species:Caenorhabditis elegans


Alignment Length:202 Identity:41/202 - (20%)
Similarity:79/202 - (39%) Gaps:49/202 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CLSQVIGAERIVNCYWGTWANYRSG-NGKFDVSNIDAGLCTHLSYSFFGINDNGEIQSLDTWLDY 75
            |..|:||              |.:| .|:..:.|....| ||..::...:|:||..::...    
 Worm   120 CDKQLIG--------------YYNGIEGRNILENQFHNL-THAVFTSEFVNENGSFENSHK---- 165

  Fly    76 DLGFINQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNHGFDGLDL 140
            :..|:.....|...||..|:: :..|:|:||.|              |:...:.:..:..||::|
 Worm   166 EQEFLECRKKLGESNSTAKIM-IAMGFNKGSCK--------------IDCITSFIEKYQVDGVEL 215

  Fly   141 DWEYPNQRGGNWNDRANFVTLL---REIKEAFAPYGYELGIAVGAGESLASASYEIANIAQQVDF 202
                      :||...:|::.|   |.:|...........:.|.|..:.:..: |:..:.:..||
 Worm   216 ----------HWNHNEHFLSQLETTRNLKNRLKKISNSKLLGVSASSNWSRVT-ELDQVLEVADF 269

  Fly   203 INVMTYD 209
            :|:..:|
 Worm   270 VNIELHD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 37/191 (19%)
Glyco_18 23..346 CDD:214753 37/191 (19%)
K08F9.3NP_001263897.1 Glyco_hydro_18 122..>272 CDD:279094 38/194 (20%)
GH18_chitinase-like 124..276 CDD:299167 38/196 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.