DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and chil-11

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_500856.2 Gene:chil-11 / 183470 WormBaseID:WBGene00016665 Length:389 Species:Caenorhabditis elegans


Alignment Length:351 Identity:76/351 - (21%)
Similarity:143/351 - (40%) Gaps:75/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DVSNIDAGLCTHLSYSFFGINDNGEIQSLDTWLDYDLG-------FINQAISLKNQNSNLKVLAV 98
            ::|.:.....||..:....:..||         .:::|       |.|...::||.:||:|.:..
 Worm    25 EISTVGLSRLTHAVFGSLRVQLNG---------TFEIGNAFSKRKFKNWQRAVKNSSSNVKSMIS 80

  Fly    99 VGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNHGFDGLDLDWEYPNQRGGNWND---RANFVT 160
            :|.| :..|:.||:..:...|:.||.|.::.|:.|..||:||.|        .|..   ::.|..
 Worm    81 IGRW-DSVTQLSSVLLNVKSRRMFIESIVDFLKEHQLDGIDLFW--------RWVPLAVQSEFCL 136

  Fly   161 LLREIKEAFAPYGYELGIAVGA---GESLASASYEIANIAQQVDFINVMTYDFAMASDGQ----T 218
            .|.|:|..|.....:..:::.|   |.......|:|..|.::|||:||.:.::|.....|    |
 Worm   137 FLEEVKIEFLNQEKQYILSITAPPVGIENYEDGYDIEEIIERVDFVNVYSMNYAAPWSNQWGTPT 201

  Fly   219 GFNAP---------QWAVENAINFWLSQGAPANKLVLGVGTYGRSFQLSDSSQNWPG------AP 268
            |.:||         :::|:..:.:::.......|..|.:..|.|.::..:::.. ||      ..
 Worm   202 GPSAPLYGGLDARRKFSVDYTMKYYIRYTRKPEKFNLIIPFYVRHWRNVENAIK-PGIEVFRNVT 265

  Fly   269 CRGEGSAGSYTGSTGYLGYNEICQNNWHTVFD--------YDNAAPYAY----SGDQWVSFDNVL 321
            .:..|:.|            |:..:.|....|        :|:.....|    ....:::|:...
 Worm   266 LQNNGAIG------------EVYMSRWTAESDGIELSNPSWDDTTKTLYIWKPETKTFITFETEK 318

  Fly   322 SVQYKMDFALSKGLAGAMIWSLETDD 347
            |::.|.::..|..|.|..||.:|.||
 Worm   319 SIEAKANYVKSMNLGGVWIWLMENDD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 76/351 (22%)
Glyco_18 23..346 CDD:214753 74/348 (21%)
chil-11NP_500856.2 Glyco_18 13..343 CDD:214753 74/348 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164295
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.