DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and chil-5

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_496127.1 Gene:chil-5 / 182435 WormBaseID:WBGene00007470 Length:459 Species:Caenorhabditis elegans


Alignment Length:389 Identity:77/389 - (19%)
Similarity:161/389 - (41%) Gaps:87/389 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVLCLSQVIGAERIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGINDNGEIQSLDTWL 73
            |..|..:::|       |:..:.|  :|     :|.....:.||:.| .|....||.| :||   
 Worm   106 AAFCGKRIVG-------YFAEFEN--AG-----LSRKQLHMLTHIIY-LFARPTNGVI-TLD--- 151

  Fly    74 DYDLG------FINQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRN 132
                |      |.......:..:|.|||:..||| ::...:||.:..:...|..|:.|.::..:.
 Worm   152 ----GEQTRRKFEEMKSKAREASSTLKVMISVGG-HDYYKEYSRLVSNETSRNVFVKSIVSFFKK 211

  Fly   133 HGFDGLDLDWEYPNQRGGNWNDRANFVTLLREIKEAFAPY--------GYELGIAVGAGESLASA 189
            :..||:::.|..|     .:.|..::.:.::|::.||...        .|.:.:.|...:..   
 Worm   212 NDIDGIEIFWTRP-----KYEDIKSYSSFIQELRSAFTELQKRWNRKNEYIISLIVPKEKHW--- 268

  Fly   190 SYEIANIAQQVDFINVMTYDFAMASDGQTGFNAPQWA-----VENAINFWLSQ-GAPA--NKLVL 246
            |:::.:.::.|||.|:.:..|   .:.|.|.::|.:.     ::..:.:::.: |.|:  |.:|.
 Worm   269 SFDLKDFSKFVDFFNIYSTQF---REKQVGPDSPLYGGEGRNIDETMKYYICKTGQPSKFNIMVS 330

  Fly   247 GVGTY--GRSFQLSDSSQN-WPGAPCRGEGSAGSYTGSTGYLGYNEICQNNWH-TVFDYDNAAPY 307
            ..||:  |....|.|.|.: |.    ....:.|.:.     :.:..:.|.||: |...:.|....
 Worm   331 FHGTFWEGAELPLRDYSDDIWK----EKNVARGPFA-----VRWRHLRQRNWNLTDIKFHNLTKT 386

  Fly   308 AYSGDQWV--------SFDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQCGETYPLLKTIN 363
            :|.   |:        :.::..|::.|..:.....:.|..:|:::.||      :.:.|||.::
 Worm   387 SYI---WIPGPPTWFLTLEDEKSLREKNRYVADHNIGGITMWTIDQDD------DDHTLLKVVS 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 74/375 (20%)
Glyco_18 23..346 CDD:214753 69/356 (19%)
chil-5NP_496127.1 Glyco_18 112..430 CDD:214753 70/364 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164288
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.