DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and chil-2

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_496133.2 Gene:chil-2 / 182431 WormBaseID:WBGene00007466 Length:383 Species:Caenorhabditis elegans


Alignment Length:353 Identity:77/353 - (21%)
Similarity:149/353 - (42%) Gaps:78/353 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ANYR------SGNGKFDVSNIDAGLCTHLSYSFFGINDNGEIQSLDTWLDYDLGFINQAISLKNQ 89
            ||::      :.:.|| :||......||..::...|..||.|:    |.:.: .|.:.|...|..
 Worm    35 ANFKCQKRVVAYSAKF-LSNHQLKKLTHFIFTSISIFPNGTIK----WPNCE-NFESYARKAKMD 93

  Fly    90 NSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNHGFDGLDLDWEYPNQRGGNWND 154
            |.|||::..:.|      |:.|:..:..|:.:||.|..:.:.:|.|||:|:.|.:|       .|
 Worm    94 NPNLKIMVEING------KFFSVLAEDEKKNSFIKSISSFVVDHKFDGVDIFWSWP-------ED 145

  Fly   155 RANFVTLLREIKEAFAPYGYELGIAVGAGESLASASYEIANIAQQ------------VDFINVMT 207
            ...|...::|.:|..              |.....|..|..:|||            :||:||::
 Worm   146 EDTFHLFIKEFREKL--------------EKHMIISIAIPRLAQQLEGFNLKLLMNHIDFLNVLS 196

  Fly   208 YDFAMASDGQTGFN----APQWA-----VENAINFWLSQGAPANKLVLGV---GTY--GRSFQLS 258
            .::.....| .|.|    :|.:.     |:..:.:........:.|.:||   |.:  |....|:
 Worm   197 INYYEPLPG-NGANIGPISPLYGGQRGNVDGTLKYLTCITKRPSILNMGVTFTGIFWNGVKDGLN 260

  Fly   259 DSSQNWPGAPCRGEGSAGSYTGSTGYLGYNEICQNNWHTVFDYDNAAPYAYSGDQ----WVSFDN 319
            :....|..|  :.|...|.      .:|:.:..::..:|:..:.:::..:|:.|.    :::|:|
 Worm   261 EQDDIWKVA--QNENGPGK------SIGWRKFIKDRRNTIPQWHDSSKSSYAWDPKSKIFLAFEN 317

  Fly   320 VLSVQYKMDFALSKGLAGAMIWSLETDD 347
            ..|:..|:.:..:|.:.|.:||:::.||
 Worm   318 EKSLSEKVIYVRNKNIGGLVIWNVDQDD 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 77/353 (22%)
Glyco_18 23..346 CDD:214753 75/350 (21%)
chil-2NP_496133.2 Glyco_18 42..344 CDD:214753 73/343 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164292
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.