DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht9 and chil-24

DIOPT Version :9

Sequence 1:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_494455.1 Gene:chil-24 / 173661 WormBaseID:WBGene00020407 Length:410 Species:Caenorhabditis elegans


Alignment Length:383 Identity:77/383 - (20%)
Similarity:157/383 - (40%) Gaps:86/383 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ERIVNCYWGTWANYRSGNG-----------------KFDVSNIDAGLCTHLSYSFFGINDNGEIQ 67
            |:..:.::...:||:..|.                 :.|:::......||..:::..:..:|   
 Worm    29 EKQDSTFFSIHSNYKMSNNETETTPSRIVGFYADWERTDITSHQVAKLTHAVFAYVQMKFDG--- 90

  Fly    68 SLDTWLDYDLGFINQAISL----------KNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNF 122
                    .|||.|.|..:          :|::||:|::..:||:......|..:|....|:. |
 Worm    91 --------SLGFKNDAARIRFSNLRDKVRRNEDSNVKMMISIGGFENSQHFYPVLSNVEMKKA-F 146

  Fly   123 INSALNLLRNHGFDGLDLDWEYPNQRGGNWNDRANFVTLLREIKEAFAPYGYELGIAVGAGESLA 187
            :||..:.|..|...|:|:.|::|:.     .|:|::...|.::::..   |||..|:|...::..
 Worm   147 LNSISSFLAYHELHGVDIFWKWPSP-----EDKAHYSRFLADLRQHL---GYEFIISVAVPQAEV 203

  Fly   188 S---ASYEIANIAQQVDFINVMTYDFAMASDGQ----TGFNAPQWA-----VENAINFWLSQGAP 240
            |   ..|::..|:..|||.||.:.|:......:    ||..:|.:.     |:..:.::..:...
 Worm   204 SNLELGYDLRTISSHVDFFNVHSMDYYGPWPNEWGKPTGPISPLYGPTRHNVDWTLRYYAEKTGE 268

  Fly   241 ANKLVLGVGTY-------------GRS-FQLSDSSQNWPGAPCRGEGSAGSYTGSTGYLGYNEIC 291
            ..||.:.:..:             ||. |:..:...|.|    :||.....::.....|   ::.
 Worm   269 PGKLNMVIPFFVRLWKNVPEPVEPGRQVFRDVELVDNKP----QGEAYMSRWSAQHEEL---DLS 326

  Fly   292 QNNWHTVFDYDNAAPYAYSGD--QWVSFDNVLSVQYKMDFALSKGLAGAMIWSLETDD 347
            ..:|    |.:..:.|.::.|  .:|:|:...|:|.||.:...|.|.|..||.::.::
 Worm   327 PADW----DEETRSSYTWNPDTRNFVTFETDKSIQEKMKYVKEKNLGGVWIWHVDANE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 76/380 (20%)
Glyco_18 23..346 CDD:214753 76/377 (20%)
chil-24NP_494455.1 Glyco_18 55..378 CDD:214753 73/353 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.