DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and Chi3l1

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001296749.1 Gene:Chi3l1 / 89824 RGDID:620874 Length:391 Species:Rattus norvegicus


Alignment Length:412 Identity:156/412 - (37%)
Similarity:228/412 - (55%) Gaps:51/412 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVSGLVKLLLGVILMAASSSAQGNSSKNVVCYQGTWSVYRPGLGKFGMEDIDPFLCTHLIYAFLG 67
            :::|...|:|          .|..|:..:|||...||.||.|.|....:.:|..||||:||:|..
  Rat    14 ALTGFAVLML----------LQSCSAYKLVCYYTNWSQYREGNGSCFPDALDHSLCTHIIYSFAN 68

  Fly    68 IE----ETGQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGGWNEGSKRFSLVARDP 128
            |.    .|.:...:..|            ...|.||.:||.||||::||||:.||:|||.:..:.
  Rat    69 ISNNKLSTSEWNDVTLY------------GMLNTLKTRNPRLKTLLSVGGWSFGSERFSRIVSNA 121

  Fly   129 SKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELK--------EGLEPF 185
            ..|:.||..|..||:.:|||||||.|.|||.:      |:.::.|.:||||        .|.|. 
  Rat   122 KSRKTFVQSVAPFLRTYGFDGLDLAWLYPGPK------DKQHFTTLIKELKAEFTKEVQPGTEK- 179

  Fly   186 GFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGPWDQVVGINAPLYAAEKDASDSSGR 250
             .:|||||.:.:.:.:..||:..:..:||.||:|.||.||.|....|.::||:..::|    :|.
  Rat   180 -LLLSAAVSAGKVTLDSGYDVAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFRGQQD----TGP 239

  Fly   251 QQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPGAPHIGKGIAGNYSREPGVLG 315
            .:..|||..|.|.|:.|||..||::|:|.:|:|||||::| ||.|||..|.|:.|.|::|.|.|.
  Rat   240 DRFSNVDYGVGYMLRLGAPTNKLVMGIPTFGKSFTLASSE-NQVGAPITGSGLPGRYTKEKGTLA 303

  Fly   316 YNELCEMMEREEWTQKWEATQQVPYAYRQRQWVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDD 380
            |.|:|:.:...|..:  ...||||:|.:..|||||:||.|:..|.:|:.:..|.|.|:|:::.||
  Rat   304 YYEICDFLRGAEVHR--ILGQQVPFATKGNQWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDD 366

  Fly   381 FRGT-CGQQ-PYPLLHEINRVL 400
            |||: ||.. .:||.:.|...|
  Rat   367 FRGSFCGHNVHFPLTNAIKEAL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 150/382 (39%)
Glyco_18 31..379 CDD:214753 140/359 (39%)
CBM_14 424..476 CDD:279884
Chi3l1NP_001296749.1 Glyco_18 31..365 CDD:214753 140/360 (39%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 150/382 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 338 1.000 Inparanoid score I2302
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.