DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and ChiC

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001319999.1 Gene:ChiC / 827725 AraportID:AT4G19810 Length:379 Species:Arabidopsis thaliana


Alignment Length:394 Identity:114/394 - (28%)
Similarity:195/394 - (49%) Gaps:51/394 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVSGLVKLLLGVILMAASSSAQGNSSKNVVCYQGTWSVYRPGLGKFGMEDIDPFLCTHLIYAFLG 67
            |.:.|:.|::.:....   :.|.:.::.||    ..|.:.|. .:|.:.|||..|.|||..||..
plant     2 SSTKLISLIVSITFFL---TLQCSMAQTVV----KASYWFPA-SEFPVTDIDSSLFTHLFCAFAD 58

  Fly    68 I-EETGQLRVIDAYLDLEENSGRGNIKSF-NALKLKNPVLKTLVAVGGWNEGSKRFSLVARDPSK 130
            : .:|.|:.|        .::.:....:| ..::.:||.:|||:::||.......::.:|.:|:.
plant    59 LNSQTNQVTV--------SSANQPKFSTFTQTVQRRNPSVKTLLSIGGGIADKTAYASMASNPTS 115

  Fly   131 REKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGL--------EPFGF 187
            |:.|:|..:|..:.:||.|||||||||...     .:.:|:.|.|:|.:..:        :| ..
plant   116 RKSFIDSSIRVARSYGFHGLDLDWEYPSSA-----TEMTNFGTLLREWRSAVVAEASSSGKP-RL 174

  Fly   188 ILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGP-WDQVVGINAPLYAAEKDASDS--SG 249
            :|:|||..:.....:.|.:.|:...||.:|:||||.:|| |.:|.|..|.|:    |.|::  ||
plant   175 LLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALF----DPSNAGPSG 235

  Fly   250 RQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPGAPHIGKGIAGNYSREPGVL 314
                   ||..:.|::||.||:|.:||.|:||.::.|..|..:...||..|..|:.:     |.:
plant   236 -------DAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAAISPD-----GSI 288

  Fly   315 GYNELCEMMEREEWTQKWEATQQVPYAYRQRQWVGYEDPRSLALKAQYVMDNHLGGIMIWSLESD 379
            ||.::.:.:.....|..:.:|....|.|....|:||:|.:|:..|.:|.....|.|...|.:.:|
plant   289 GYGQIRKFIVDNGATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGAD 353

  Fly   380 DFRG 383
            |..|
plant   354 DNSG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 110/366 (30%)
Glyco_18 31..379 CDD:214753 107/360 (30%)
CBM_14 424..476 CDD:279884
ChiCNP_001319999.1 GH18_plant_chitinase_class_V 25..359 CDD:119358 110/368 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 1 0.900 - - OOG6_100224
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.