DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and AT4G19800

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_193715.1 Gene:AT4G19800 / 827724 AraportID:AT4G19800 Length:398 Species:Arabidopsis thaliana


Alignment Length:365 Identity:109/365 - (29%)
Similarity:161/365 - (44%) Gaps:54/365 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FGMEDIDPFLCTHLIYAFLGIEETGQLRVIDAYLDLEENSGRGNIKSFN---------ALKLKNP 103
            |...|||..|.|||...|               .|||..|....|.::|         .::.:||
plant    18 FPATDIDSSLFTHLFCTF---------------ADLEAESYEITIATWNQAPFHAFTETVQQRNP 67

  Fly   104 VLKTLVAVGGWNEGSKRFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDR 168
            .:|||:::||.|.....|:.:|.:|..|..|:...:...:.:||.|||||||||     .:.|:.
plant    68 HVKTLLSIGGGNADKDAFASMASNPDSRASFIQSTITVARSYGFHGLDLDWEYP-----RNEEEM 127

  Fly   169 SNYITFLKELKEGLE-------PFGFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGP 226
            .::...|:|.:..:|       ....||:|||..:.....:.|.:.|:...||.||:||||.:||
plant   128 YDFGKLLEEWRSAVEAESNSSGTTALILTAAVYYSSNYQGVPYPVLAISNSLDWINLMAYDFYGP 192

  Fly   227 -WDQVVGINAPLYAAEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAE 290
             |..|.|..|.||......|..||          |:.|.:||.||:|.:||.|:||.::|||..:
plant   193 GWSTVTGPPASLYLPTDGRSGDSG----------VRDWTEAGLPAKKAVLGFPYYGWAWTLADPD 247

  Fly   291 GNQPGAPHIGKGIAGNYSREPGVLGYNELCEMMEREEWTQKWEATQQVPYAYRQRQWVGYEDPRS 355
            .|...|...|..|:     :.|.:.|.:|...:.....|:..:......|.|....|:||:..:|
plant   248 VNGYDANTTGPAIS-----DDGEISYRQLQTWIVDNGATKVHDDMMVGDYCYAGTTWIGYDSEKS 307

  Fly   356 LALKAQYVMDNHLGGIMIWSLESDDFR--GTCGQQPYPLL 393
            :..|..|.....|.|...|.:..||..  .:.|..||.:|
plant   308 IVTKVIYAKQKGLLGYFSWHVGGDDNSELSSAGSTPYHIL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 109/365 (30%)
Glyco_18 31..379 CDD:214753 103/347 (30%)
CBM_14 424..476 CDD:279884
AT4G19800NP_193715.1 GH18_plant_chitinase_class_V 4..337 CDD:119358 105/353 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 1 0.900 - - OOG6_100224
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.