DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and AT4G19770

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:279 Identity:82/279 - (29%)
Similarity:125/279 - (44%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 REKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGLEPFGF-------I 188
            |:.|:...:...:.:||||||||||||  |::   .:.|::...|||.:..::...:       |
plant     8 RKSFILSTISIARSYGFDGLDLDWEYP--RNA---AEMSDFAELLKEWRYAVQGEAYSSELPVLI 67

  Fly   189 LSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGP-WDQVVGINAPLYAAEKDASDSSGRQQ 252
            |:|.|..:.....:.|.:..:...||.:|:.|||.:|| ..:|.|..|.||......|..||   
plant    68 LTATVYYSSNYNGVVYPVKFISELLDWVNIKAYDFYGPGCTEVTGPPAALYLQSDGPSGDSG--- 129

  Fly   253 QLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPGAPHIGKGIAGNYSREPGVLGYN 317
                   ||.|:.||.||||.:||.|:||.::|||..:.:.......|..|:     :.|.:.|:
plant   130 -------VKDWIDAGLPAEKAVLGFPYYGWAWTLADPKNHGYYVDTTGPAIS-----DDGEISYS 182

  Fly   318 ELCEMMEREEWTQKWEATQQ------VPYAYRQRQWVGYEDPRSLALKAQYVMDNHLGGIMIWSL 376
            :|      :.|....:||..      ..|.|....|:||:...|:..|..|.....|.|...|.:
plant   183 QL------KTWIVDNKATTVHDNIVIGDYCYAGTTWIGYDSEESIVTKVIYAKQKGLLGYFSWQV 241

  Fly   377 ESDDFR--GTCGQQPYPLL 393
            ..||..  .:.|..||.:|
plant   242 GGDDKSELSSAGSSPYHIL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 82/279 (29%)
Glyco_18 31..379 CDD:214753 76/261 (29%)
CBM_14 424..476 CDD:279884
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 78/267 (29%)
Glyco_18 <1..244 CDD:214753 76/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 1 0.900 - - OOG6_100224
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.