DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and AT4G19740

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana


Alignment Length:172 Identity:52/172 - (30%)
Similarity:85/172 - (49%) Gaps:26/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKE-------- 180
            :|.:.:.||.|:...:...:..||.||||.||||.     ::.:.:|:...|:|.:.        
plant     1 MASNRTSRESFISSSISIARSLGFYGLDLAWEYPN-----NDVEMNNFGKLLQEWRSAVEVESQR 60

  Fly   181 -GLEPFGFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGPWDQVVGINAPLYAAEKDA 244
             |:.|  .:|:|||........:||.:.|:...||.:|::||:.:|...: :|..|.||  :...
plant    61 TGIRP--LLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFYGLTTE-IGPPAGLY--DPSI 120

  Fly   245 SDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTL 286
            ....|       |..:|:|||||.|.:|.:.|.|:.|.|:||
plant   121 KGPCG-------DTGLKHWLKAGLPEKKAVFGFPYVGWSWTL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 52/172 (30%)
Glyco_18 31..379 CDD:214753 52/172 (30%)
CBM_14 424..476 CDD:279884
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:415847 48/150 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 1 0.900 - - OOG6_100224
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.