DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and AT4G19720

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001319998.1 Gene:AT4G19720 / 827716 AraportID:AT4G19720 Length:363 Species:Arabidopsis thaliana


Alignment Length:336 Identity:92/336 - (27%)
Similarity:162/336 - (48%) Gaps:38/336 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IDPFLCTHLIYAFLGIE-ETGQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGGWNE 116
            ||..|.|||..||..:: :|..:.|..|:  .:|.|....|     :|.|||.::||:::||.|.
plant    33 IDSTLFTHLFCAFADLDPQTNSVVVSGAH--EQEFSNFTKI-----VKKKNPHVQTLLSIGGRNA 90

  Fly   117 GSKRFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEG 181
            ....|:.:|.:|:.|:.|:...:...:.:.||||||.|:||     .|:.:..|:...|::.:|.
plant    91 DKSAFASMASNPTSRKSFIWSAISSARYYRFDGLDLVWKYP-----KDDVEMRNFGQLLEQWREA 150

  Fly   182 LEP-------FGFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGPWDQVVGINAPLYA 239
            :|.       ...:|:|||..:.....:||.|..:...||.:|::|||.:.. ...:|..|.|: 
plant   151 IEDDAERTERMPLLLTAAVYYSPVYDSVSYPIREIKKKLDWVNLIAYDFYSS-STTIGPPAALF- 213

  Fly   240 AEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPGAPHIGKGIA 304
               |.|:..|...    |..:|.|:|||.||:|.:||.|:.|.:::|.:  ||......:.....
plant   214 ---DPSNPKGPCG----DYGLKEWIKAGLPAKKAVLGFPYVGWTWSLGS--GNDAATSRVATSAE 269

  Fly   305 GNYSREPGVLGYNELCEMMEREEWTQKWEATQQVPYAYRQRQWVGYEDPRSLALKAQYVMDNHLG 369
            |:       :.|:::..::...:....:::|....|.:.....:||:|.:|:..|.:|.....|.
plant   270 GS-------INYDQIKRLIVDHKARPVFDSTVVGDYCFAGTSLIGYDDHQSVVAKVKYAKQKGLL 327

  Fly   370 GIMIWSLESDD 380
            |...|.:.:||
plant   328 GYFSWHVGADD 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 92/336 (27%)
Glyco_18 31..379 CDD:214753 90/333 (27%)
CBM_14 424..476 CDD:279884
AT4G19720NP_001319998.1 GH18_plant_chitinase_class_V 3..343 CDD:119358 92/336 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 1 0.900 - - OOG6_100224
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.