DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and CG13837

DIOPT Version :10

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster


Alignment Length:202 Identity:43/202 - (21%)
Similarity:67/202 - (33%) Gaps:47/202 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 APHIGKGIAGN-------YSREPGVLGYNELCEMMEREEWTQKWEATQQVPYAYRQRQWVGY--- 350
            ||.:|..:|.:       |...||...    .|.::...:.:|.|.........|.|..||.   
  Fly    30 APQLGVYVASSSNCSKYIYCAGPGSFE----AECLDGHYYDEKLERCLDRKLVSRCRDPVGITTK 90

  Fly   351 -----------EDPRSLALKAQYVMDNHLGGIMIWSLESDDFRGTCGQQPYPLLHEINRVLFGGN 404
                       .:|.::.|:   ::.|               .|.|  .||.:.:| ...|....
  Fly    91 SPSMVKKPAQKAEPLAITLR---LLPN---------------AGPC--YPYMVCYE-GAGLAKAC 134

  Fly   405 TPSGLTTESNRESPSEGFSCPADAPAGYIRDPDNCSKFYYCSGGKTHNFDCPSGLNFDLDTKSCN 469
            ||:.|.: .||....|......:...|::..|.||:.|||||.|......|.....:..:.:||.
  Fly   135 TPAHLVS-CNRMQTRENIINCQEGVYGFMPHPRNCAYFYYCSSGSKLVHRCHLNYTWHYERRSCV 198

  Fly   470 YSGSVKC 476
            ......|
  Fly   199 QQSERMC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 22/124 (18%)
CBM_14 424..476 CDD:426342 13/51 (25%)
CG13837NP_651113.1 CBM_14 36..81 CDD:426342 7/48 (15%)
CBM_14 154..203 CDD:426342 13/48 (27%)

Return to query results.
Submit another query.