DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and Cht9

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster


Alignment Length:395 Identity:168/395 - (42%)
Similarity:230/395 - (58%) Gaps:30/395 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLVKLLLGVILMAASSSAQGNSSKNVVCYQGTWSVYRPGLGKFGMEDIDPFLCTHLIYAFLGIEE 70
            |.:..||.|:.::....|:    :.|.||.|||:.||.|.|||.:.:||..|||||.|:|.||.:
  Fly     2 GKLLALLAVLCLSQVIGAE----RIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGIND 62

  Fly    71 TGQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGGWNEGSKRFSLVARDPSKREKFV 135
            .|:::.:|.:||.:    .|.|....:||.:|..||.|..||||||||.::|.::.|..||:.|:
  Fly    63 NGEIQSLDTWLDYD----LGFINQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFI 123

  Fly   136 DDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGLEPFGFILSAAVGSAQFSA 200
            :..:..|:.|||||||||||||.||....| ||:|::|.|:|:||...|:|:.|..|||:.:..|
  Fly   124 NSALNLLRNHGFDGLDLDWEYPNQRGGNWN-DRANFVTLLREIKEAFAPYGYELGIAVGAGESLA 187

  Fly   201 EISYDIPAMVPYLDLINVMAYDLHGPWDQVVGINAPLYAAEKDASDSSGRQQQLNVDAVVKYWLK 265
            ..||:|..:...:|.||||.||.....|...|.|||.:|.|.                .:.:||.
  Fly   188 SASYEIANIAQQVDFINVMTYDFAMASDGQTGFNAPQWAVEN----------------AINFWLS 236

  Fly   266 AGAPAEKLILGVPFYGRSFTLATAEGNQPGAPHIGKGIAGNYSREPGVLGYNELCEMMEREEWTQ 330
            .||||.||:|||..|||||.|:.:..|.||||..|:|.||:|:...|.|||||:|:    ..|..
  Fly   237 QGAPANKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSYTGSTGYLGYNEICQ----NNWHT 297

  Fly   331 KWEATQQVPYAYRQRQWVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDDFRGTCGQQPYPLLHE 395
            .::.....||||...|||.:::..|:..|..:.:...|.|.||||||:||:||.|| :.||||..
  Fly   298 VFDYDNAAPYAYSGDQWVSFDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQCG-ETYPLLKT 361

  Fly   396 INRVL 400
            |||.|
  Fly   362 INRKL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 162/368 (44%)
Glyco_18 31..379 CDD:214753 149/347 (43%)
CBM_14 424..476 CDD:279884
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 162/368 (44%)
Glyco_18 23..346 CDD:214753 149/347 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469218
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
Isobase 1 0.950 - 0 Normalized mean entropy S2811
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
1110.850

Return to query results.
Submit another query.