DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and Idgf6

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster


Alignment Length:456 Identity:136/456 - (29%)
Similarity:213/456 - (46%) Gaps:77/456 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVKLLLGVILMAASSSAQGNSS-----KNVVCYQGTWSVYRPGLGKFGMEDIDPFL--CTHLIYA 64
            ::|.|..|.|..||..|....:     |::|||..:.|..:.||||..:::::|.|  |.:|:|.
  Fly     2 IIKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYG 66

  Fly    65 FLGIEETGQLRV-IDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGG---------WNEGSK 119
            :.|||......| ::..|||:  .|:|..::...||.|.|.:|.|::|||         ..|...
  Fly    67 YAGIERDSHKAVSLNQQLDLD--LGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPN 129

  Fly   120 RFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQR----HS------------------ 162
            ::..:...|:.|.:||:.|...::.:||||||:.|::|..:    ||                  
  Fly   130 KYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSI 194

  Fly   163 ---LDNEDRSNYITFLKELKEGLEPFGFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLH 224
               ...|.:..:...|:::|....|...:||..| ....::.:.|||||:|.|||.:|:..:|..
  Fly   195 VDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTV-LPNVNSSLFYDIPAVVNYLDFVNLGTFDFF 258

  Fly   225 GPW--DQVVGINAPLYAAEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLA 287
            .|.  .:|....||:|       :.|.|..:.||.|.|||||:...||.|:.:||..|||.:.| 
  Fly   259 TPQRNPEVADYAAPIY-------ELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKL- 315

  Fly   288 TAEGNQPGAPHI----GKGIAGNYSREPGVLGYNELCEMMEREEWTQKWEATQ-----QVP---- 339
            |.:....|.|.:    .:...|..::.||:..:.|:|.::..:.......|..     |.|    
  Fly   316 TDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRF 380

  Fly   340 --YAYRQRQ-------WVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDDFRGTCGQQPYPLLHE 395
              ||||...       ||.:|||.:.|.||.||...:|||:.::.|..|||||.|..:.||:|..
  Fly   381 GSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRA 445

  Fly   396 I 396
            |
  Fly   446 I 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 128/427 (30%)
Glyco_18 31..379 CDD:214753 118/408 (29%)
CBM_14 424..476 CDD:279884
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 128/428 (30%)
Glyco_18 31..429 CDD:214753 118/408 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463811
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1336
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
65.890

Return to query results.
Submit another query.