DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and btb-18

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_872066.2 Gene:btb-18 / 353391 WormBaseID:WBGene00018201 Length:298 Species:Caenorhabditis elegans


Alignment Length:171 Identity:35/171 - (20%)
Similarity:56/171 - (32%) Gaps:53/171 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FLCTH------LIYAFLGIEETGQLRVID-AYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGG 113
            |||.|      |.::.|..:.:.::.:.| .|.|.      |::.|   ....|||..       
 Worm   157 FLCYHSDHFRELFFSNLKKDASVEIELRDVVYEDF------GHLMS---TIHPNPVFP------- 205

  Fly   114 WNEGSKRFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKEL 178
             |:.|....||..|..|.:..:|.|                    :.|.|.|...:|........
 Worm   206 -NDRSVEKILVLADRFKVQSAIDHV--------------------EHHLLHNSRLANECMMWMAD 249

  Fly   179 KEGLEPFGFILSAAVGSAQ---------FSAEISYDIPAMV 210
            |.|::....|....:||.:         ..|.:|::...||
 Worm   250 KYGMKKLLKISIQNIGSLENAKNLKNSTLFASLSHNAKVMV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 35/171 (20%)
Glyco_18 31..379 CDD:214753 35/171 (20%)
CBM_14 424..476 CDD:279884
btb-18NP_872066.2 BTB 141..237 CDD:197585 24/116 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.