DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and Idgf3

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster


Alignment Length:453 Identity:118/453 - (26%)
Similarity:209/453 - (46%) Gaps:77/453 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSGLVKLLLGVILMAASSSAQGNSSKNVVCYQGTWSVYRPGLGKFGMEDIDPFL--CTHLIYAFL 66
            ::|.:.|.|.:.| |..:..:.:::.|:||:..:....|.||.:|.|.||:..|  ||||:|.:.
  Fly     1 MTGSLWLSLALSL-AVLAQFKVSAAPNLVCFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYA 64

  Fly    67 GIE-ETGQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGG---WNEGSKRFSLVARD 127
            |:. :..:::.|:..||||:.    ::....::|.:.|.:|.|::|||   ..||::...|:...
  Fly    65 GVNADNYEMQSINKRLDLEQR----HLAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESG 125

  Fly   128 PSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQR----H--------------------SLDNEDR 168
            .....:|::.....::|:.||||||..:.|..:    |                    ..::|..
  Fly   126 QQGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETH 190

  Fly   169 SNYIT-FLKELKEGLEPFGFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGPW--DQV 230
            ...:| .:|:|...|:....:||..| ....::...||.|::.|.||.||:..:|...|.  .:.
  Fly   191 KGQVTALIKDLSAALKQNDLLLSLTV-LPNVNSSWYYDAPSIAPSLDFINLGTFDFLTPQRNPEE 254

  Fly   231 VGINAPLYAAEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPG 295
            ...:||.|.|.     ...|....|::..:::||....||.|:.:|:..||||:.::...|:. |
  Fly   255 ADFSAPTYEAV-----GQNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWKMSKDSGDS-G 313

  Fly   296 APHI----GKGIAGNYSREPGVLGYNELCEMMERE----------------EWTQKWEATQQVPY 340
            .|.:    |...||..|::.|:|.:.|:|.:|...                :.|:::.:     |
  Fly   314 MPVVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGS-----Y 373

  Fly   341 AYRQRQ-------WVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDDFRGTCGQQPYPLLHEI 396
            |:|...       |:.|:||.|.:.||.|....:|||:.::.|..|||||.|....:|:|..|
  Fly   374 AFRAADENGDHGLWISYDDPDSASSKAMYARARNLGGVALFDLTQDDFRGQCTNDRFPMLRAI 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 112/426 (26%)
Glyco_18 31..379 CDD:214753 103/407 (25%)
CBM_14 424..476 CDD:279884
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 113/427 (26%)
Glyco_18 27..419 CDD:214753 103/407 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.