DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and Idgf1

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster


Alignment Length:454 Identity:128/454 - (28%)
Similarity:204/454 - (44%) Gaps:85/454 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKLLLGVILMAASSSAQGNSSKNVVCYQGTWSVYRPGLGKFGMEDIDPFL--CTHLIYAFLGIEE 70
            ::..|..||...|.::..:::.|::||..:.|..|.||.|....::|..|  ||||:|.:.|: :
  Fly     1 MRFQLFYILGLLSVTSLTHAASNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGL-K 64

  Fly    71 TGQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGGWNE-----GSKRFSLVARDPSK 130
            :|.|.:....:||:    ....|...||:.|.|.||.|::|||..:     .:|...|:..:.:.
  Fly    65 SGTLELFSLNVDLD----MFYYKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTA 125

  Fly   131 REKFVDDVVRFLQRHGFDGLDLDWEYPGQR----H-SLDN--------------------EDRSN 170
            ::.|:|..:..|:|:|||||||.::.|..:    | ||.:                    |.:|.
  Fly   126 QQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQ 190

  Fly   171 YITFLKELKEGLEPFGFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYD----LHGPWDQVV 231
            :...:..:|........:||..| ....::...:|:|.:.|..|.||:.|:|    |..|  :..
  Fly   191 FTDLVGNIKNAFRSANLMLSLTV-LPNVNSTWYFDVPKLHPQFDYINLAAFDFLTPLRNP--EEA 252

  Fly   232 GINAPLYAAEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPGA 296
            ...||::     ..|...|...|||:..:.|||:...|.:||.||:..|||::.|:...| ..||
  Fly   253 DFTAPIF-----FQDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGSG-LSGA 311

  Fly   297 P--HIGKGIAGN----YSREPGVLGYNELCEMMERE----------------EWTQKWEATQQVP 339
            |  |...|:|..    .|.| |:|.:.|:|..:.:.                :.|||:.     .
  Fly   312 PIVHETCGVAPGGIQIQSAE-GLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYG-----N 370

  Fly   340 YAYRQRQ-------WVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDDFRGTCGQQPYPLLHEI 396
            ||.|...       |:.::||....:||.|.....||||.::.|..|||||.|..|.||:|..|
  Fly   371 YALRPADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGLCTGQKYPILRSI 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 123/431 (29%)
Glyco_18 31..379 CDD:214753 112/412 (27%)
CBM_14 424..476 CDD:279884
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 124/432 (29%)
Glyco_18 24..417 CDD:214753 112/412 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463813
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.