DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and Cht10

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:546 Identity:176/546 - (32%)
Similarity:255/546 - (46%) Gaps:118/546 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SKNVVCYQGTWSVYRPGLGKFGMEDIDPFLCTHLIYAFLGIE-ETGQLRVIDAYLDLEENSGRGN 91
            :|.|:||...|:.||.|...|..|.|||.||:.:||:|..:: :...:|..|:::||:....|  
  Fly   218 TKKVLCYMSNWAFYRSGEAHFVPEQIDPNLCSAIIYSFASLDPDHLTIREFDSWVDLDNQYYR-- 280

  Fly    92 IKSFNALKLKNPVLKTLVAVGGWNEGS-KRFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWE 155
                ....|..||   |:|:|||.:.| .::|.:..|..||..|:..|..||.||||.||.|||.
  Fly   281 ----RVTSLGVPV---LIALGGWTDSSGSKYSRLVSDNLKRRVFISSVSSFLLRHGFSGLHLDWN 338

  Fly   156 YPGQRHSLDNE----DRSNYITFLKELK---EGLEPFGFILSAAVGSAQFSAEISYDIPAMVPYL 213
            ||....|..:.    ||.|....|:||:   :.::| .|.|..|:...:...:.:||.||:...:
  Fly   339 YPKCWQSDCSRGPVTDRPNLTKLLRELRTEFQSVDP-KFQLGVAISGYKEIIKEAYDFPALSDIV 402

  Fly   214 DLINVMAYDLHGPWDQVVGINAPLYAAEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVP 278
            |.:.||.||.||.|:|..|..:|||..      ||....|.|.:..::..||.||..|||:|.:|
  Fly   403 DYMTVMTYDYHGAWEQKTGHVSPLYGL------SSDTYPQYNTNYTMQLLLKMGARREKLVLSIP 461

  Fly   279 FYGRSFTLATAEGNQ----PGAPHIGKGIAGNYSREPGVLGYNELCEMMEREEWTQKWEATQQV- 338
            |||:|||||||  :|    ||....|.|.||..:::||:|.|.|:|:.:.:..|..  :....| 
  Fly   462 FYGQSFTLATA--HQILAGPGVAASGPGDAGELTKQPGMLAYYEICQRLTKFNWIS--DRNLNVI 522

  Fly   339 --PYAYRQRQWVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDDFRGTCGQQPYPLLHEINRVL- 400
              |:|....||||||||.|...||:|..:|:..|:..|:::.||||..|..:.||||..|||.| 
  Fly   523 FGPFAMLNDQWVGYEDPTSAQAKARYAANNNFAGVAAWTIDLDDFRNLCCNESYPLLRAINRALG 587

  Fly   401 ---------------------------------FGG---------NTPSG--------------- 408
                                             .||         :.|||               
  Fly   588 RLDSEPPTQPNCKRPTLLATPVPPQMTTISSDGSGGLGQNHDHTTSLPSGQISSSPVSTTITSTF 652

  Fly   409 ----LTTESNRESPSEGFSCPADA----PAG--------------YIRDPDNCSKFYYC-SGGKT 450
                .||:..|| |::..:.|...    |||              :..|.:||:.:|:| ..|:.
  Fly   653 PWWSSTTKRPRE-PTKTTAQPTHTTILIPAGINPVVQPSNCKSGEFFADSNNCNAYYHCFFAGEL 716

  Fly   451 HNFDCPSGLNFDLDTKSCNYSGSVKC 476
            ....|||||:::.:.|.|::..|.:|
  Fly   717 QQQFCPSGLHWNNEAKGCDWPSSAQC 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 145/384 (38%)
Glyco_18 31..379 CDD:214753 133/363 (37%)
CBM_14 424..476 CDD:279884 18/70 (26%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753 133/364 (37%)
GH18_chitolectin_chitotriosidase 221..586 CDD:119351 145/384 (38%)
ChtBD2 697..737 CDD:214696 13/39 (33%)
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463774
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.