DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and Cda4

DIOPT Version :10

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster


Alignment Length:68 Identity:24/68 - (35%)
Similarity:31/68 - (45%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 LTTESNRESPSEGFSCPADAPAGYIRDPDNCSKFYYCSGGKTHNFDCPSGLNFDLDTKSCNYSGS 473
            :|..:.:....|.|.||:....|...||..|.:||.|..|..:...|||||.||...|.|.:...
  Fly    13 ITGANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTFKDE 77

  Fly   474 VKC 476
            .||
  Fly    78 AKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351
CBM_14 424..476 CDD:426342 19/51 (37%)
Cda4NP_728468.1 CBM_14 33..80 CDD:426342 17/46 (37%)
CE4_CDA_like_1 130..396 CDD:200596
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.