DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and Cht6

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster


Alignment Length:547 Identity:195/547 - (35%)
Similarity:283/547 - (51%) Gaps:103/547 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QGNSSKNVVCYQGTWSVYRPGLGKFGMEDIDPFLCTHLIYAFLGIEETGQLRVIDAYLDLEENSG 88
            :.:|...||||...|||||||..||..::|:|:|||||:|||.|..:..|::..|.|.|:|:   
  Fly    25 EASSEGRVVCYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAFGGFTKDNQMKPFDKYQDIEQ--- 86

  Fly    89 RGNIKSFNALKLKNPVLKTLVAVGGWNEGSKRFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLD 153
             |....|..||..|..|||::|:|||||.|.|||.:.....:|::|:.::::||:::.|||:|||
  Fly    87 -GGYAKFTGLKTYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQNHFDGIDLD 150

  Fly   154 WEYPGQRHSLDNEDRSNYITFLKELKEGLEPFG-------FILSAAVGSAQFSAEISYDIPAMVP 211
            ||||..|....:.||.||..|::||:...|...       .:|:.||.:.....:..||:|.:..
  Fly   151 WEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVPAGIEYIDKGYDVPKLNK 215

  Fly   212 YLDLINVMAYDLHGPWDQVVGINAPLYAAEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILG 276
            |||..||:.||.|...:..|..:||||:.|:|:  ......:||:|..:||:|||||..:||:||
  Fly   216 YLDWFNVLTYDFHSSHEPSVNHHAPLYSLEEDS--EYNYDAELNIDYSIKYYLKAGADRDKLVLG 278

  Fly   277 VPFYGRSFTLATAEGNQPGAPHIGKGIAGNYSREPGVLGYNELCEMMERE-EWT-QKWEATQQVP 339
            :|.||||:||...|..:.|||..|.|..|:.:||.|.|.|.|:|:.::.: ||| .:..|....|
  Fly   279 IPTYGRSYTLINEESTELGAPAEGPGEQGDATREKGYLAYYEICQTLKDDPEWTVVQPNANVMGP 343

  Fly   340 YAYRQRQWVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDDFRGTCGQQPYPL------------ 392
            ||||:.|||||:|...:..||:||:...|||||.|::::|||||||..:||||            
  Fly   344 YAYRRNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDDFRGTCNGKPYPLIEAAKEAMVEAL 408

  Fly   393 ---LHEI-------------------NRVLFGGNTPSGLT------------------------- 410
               ::|:                   ||....|.|.:.|:                         
  Fly   409 GLGINEVAKPSGPQKPSRSRSRDNASNRNRLNGKTEAPLSSRRPSATRRPAVSSTQAPPPSTTFK 473

  Fly   411 -TESNRES------------------PSEGFSCPADAPAGYIRDPDNCSKFYYC--SGGK----- 449
             ||:...|                  |...|.|..:   |:.:.|.:|.|:|:|  ||..     
  Fly   474 LTEAEGSSLYIGGRASTTPPPPTTPDPGSDFKCEEE---GFFQHPRDCKKYYWCLDSGPSGLGIV 535

  Fly   450 THNFDCPSGLNFDLDTKSCNYSGSVKC 476
            .|.|.|||||.|:....||:::.:|.|
  Fly   536 AHMFTCPSGLYFNPAADSCDFARNVPC 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 165/411 (40%)
Glyco_18 31..379 CDD:214753 151/356 (42%)
CBM_14 424..476 CDD:279884 20/58 (34%)
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 151/357 (42%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 162/377 (43%)
CBM_14 506..562 CDD:279884 20/58 (34%)
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2066
SonicParanoid 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.