DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and Cht11

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster


Alignment Length:429 Identity:122/429 - (28%)
Similarity:205/429 - (47%) Gaps:65/429 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WS--VSGLVKLLLGVI---LMAASSSAQGNSSKNVVCYQGTWSVYRPGLGKFGMEDIDPFLCTHL 61
            ||  :..|:.|.||.|   |:...:.......:.:|||..:     .|.....:.|:...||||:
  Fly    35 WSALLFSLLCLCLGFIGLGLLGIQTGEVHKVGQRLVCYYAS-----DGTHNLSLLDVPGDLCTHI 94

  Fly    62 IYAFLGIEETGQLRVIDAYLDLEENSG---RGNIKSFNALKLKNPVLKTLVAVGGWNEGSKRFSL 123
                    ..|...:.:|.:.|.:...   :.:.:||.|   .:|.:..|:.:||.:.| :.|:|
  Fly    95 --------NIGPATLDNATIVLPDTLRQVLQNDTRSFRA---AHPQVHLLLWIGGADSG-RSFAL 147

  Fly   124 VARDPSKREKFVDDVVRFLQRH-GFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELK---EGLEP 184
            :..:.:.|:.|:..:...|:.: ..||:|||||:|    |..:.:|.:....|.|::   ...:.
  Fly   148 MVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFP----SAYDRERMHLSQLLYEIRTEWRREKR 208

  Fly   185 FGFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLH-----GPWDQVVGINAPLYAAEKDA 244
            ...|||.||.:.:..|..:|||..:..|.|.:|:|:||.|     .|:   .|:||||||..::.
  Fly   209 TNDILSLAVAAPEGIAFYAYDIREINLYADYVNLMSYDFHFYREDTPF---TGLNAPLYARSQER 270

  Fly   245 SDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPGAPHIGKGIAGNYSR 309
            |    .....|::..|::|||:|...::|::|:|.||.||||.....::.|||..|.|..|.   
  Fly   271 S----LMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCGQ--- 328

  Fly   310 EPGVLGY---NELCEMMER-EEWTQKWEATQQVPYAYRQRQWVGYEDPRSLALKAQYVMDNHLGG 370
                ||:   .|.||.:.: .:....::|....||....::|:.||:..|:|.||.||...:|||
  Fly   329 ----LGFTTLTETCECVTKFFKPNLSYDAESCSPYLSALQEWISYENQTSIACKANYVKSLNLGG 389

  Fly   371 IMIWSLESDDFRGTCGQQP---------YPLLHEINRVL 400
            :|::||.:||.:.:|...|         :||...|..:|
  Fly   390 VMVFSLNTDDLKNSCSIMPNLKYSEKPVFPLTQAIKDIL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 113/393 (29%)
Glyco_18 31..379 CDD:214753 106/363 (29%)
CBM_14 424..476 CDD:279884
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 106/364 (29%)
GH18_chitinase-like 69..428 CDD:299167 113/393 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.