DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and chil-9

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001366720.1 Gene:chil-9 / 191470 WormBaseID:WBGene00014162 Length:460 Species:Caenorhabditis elegans


Alignment Length:425 Identity:97/425 - (22%)
Similarity:181/425 - (42%) Gaps:105/425 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVSGLVKLLLGVILMAASSSAQGNSSKNVVCYQGTWSVYRPGLGKFGMEDIDPF----------- 56
            :||.|::||: .....:.::.:.|.|......|.:...:.|.....|...:..|           
 Worm    66 AVSNLIELLI-PSSKTSRTTTKTNDSTMTKLVQKSDENFSPPAAFCGKRIVGYFAEFENTALTRK 129

  Fly    57 ---LCTHLIYAF---------LGIEETGQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLV 109
               :.||:::.|         .|.|.:.|        ..||.  |.|::..::      .||.::
 Worm   130 QLRMLTHIVFLFAFPKNGTITFGGESSSQ--------KFEEM--RRNVRKASS------TLKVMI 178

  Fly   110 AVGG-WNEGSKRFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYIT 173
            ::|| :|.|  .||.:..:.:.|..||:.:..|::.:..||:|:.|.:|  :||    |.:||:.
 Worm   179 SIGGQYNSG--EFSGLVSNETSRNLFVNSIATFVRDYDIDGVDIFWTWP--KHS----DENNYLM 235

  Fly   174 FLKELKEGL----------EPF--GFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGP 226
            |::||:...          |.|  ..::|..|.......|.|       .::|.||:.:::   .
 Worm   236 FIRELRYAFTELQKKLNRKETFVISLVISRNVNHLSKLVEFS-------NFVDFINIYSFN---S 290

  Fly   227 WDQVVGINAPLYAAEKDASDSSGRQQQLNVDAVVKYWL-KAGAPAEKLILGVPFYGRSFTLATAE 290
            :...||.::|||        ..|.:   |||.::||:: |.|.|::..|: |.|:...:     |
 Worm   291 YLYQVGPDSPLY--------GGGSR---NVDEIMKYYICKTGQPSKFNII-VSFHATYW-----E 338

  Fly   291 GNQPGAPHIGKGIAGNYSREPGVLGYNELCEMMEREEWTQKWEATQ-------QVPYAY---RQR 345
            |.:.........|..:.:...|  |:    .:..||...|||:.:.       :..|.:   ...
 Worm   339 GAELPLRDDSDDIFKDQNSAKG--GF----AVRWRELLQQKWDMSNIKFHNLTKTSYMWIPGPPT 397

  Fly   346 QWVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDD 380
            :::..||.:||..|.:||.|:::|||.:|:::.||
 Worm   398 RFMTLEDEKSLREKNRYVADHNIGGITMWTIDQDD 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 90/397 (23%)
Glyco_18 31..379 CDD:214753 88/394 (22%)
CBM_14 424..476 CDD:279884
chil-9NP_001366720.1 Glyco_18 113..431 CDD:214753 85/374 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164312
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.