DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and cht-4

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_497437.2 Gene:cht-4 / 189507 WormBaseID:WBGene00021252 Length:360 Species:Caenorhabditis elegans


Alignment Length:379 Identity:109/379 - (28%)
Similarity:175/379 - (46%) Gaps:51/379 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VVCYQGTWSVYRPGLGKFGMEDIDPFLCTHLIYA-FLGIEETGQLRVIDAYLDLEENSG--RGNI 92
            |.||   :.:.:|.:.|     :...||||:|.. ...:.|.|:|:..:.  |||..|.  .|.|
 Worm    20 VACY---YILNQPDISK-----VPKNLCTHIILINSAHVSEDGRLQGFEQ--DLEHFSELFDGKI 74

  Fly    93 KSFNALKLKNPVLKTLVAVGGWNEGSKRFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYP 157
            :.|.::...||                .||.:..:.:....|...|.:.||::..:|:|:|||:|
 Worm    75 ELFVSITSSNP----------------SFSFLTSNTTLMHNFSSTVTQVLQKYRLNGVDIDWEFP 123

  Fly   158 GQRHSLDNEDRSNYITFLKELKEGLEPFGFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYD 222
            .........|::::.|||:.||..|:|....||.||......:..:||:.|:..|.|::.:|.||
 Worm   124 VWSRDAQKSDKAHFATFLRILKSHLKPADLKLSVAVSGPPTISRKAYDVDALKMYADMVQIMNYD 188

  Fly   223 LH------GPWDQVVGINAPLYAAEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYG 281
            .|      .|:   ||.||||:....:.|...    ::|.:|.:|.|...|.|......|:|.|.
 Worm   189 FHVFNRYSNPF---VGFNAPLHPMRAEISVLG----EMNAEASMKTWYDLGLPRNISFFGIPTYA 246

  Fly   282 RSFTLATAEGNQPGAPHIGKGIAGNYSREPGVLGYNELCEMMEREEWTQKWEATQQVPYAYRQRQ 346
            |:|.|.|...::|.:|.|        ...|.:....::|...:...:|..|....|.||.|....
 Worm   247 RAFQLLTHYLHKPYSPAI--------RARPEITNLPDVCIFAQSGYYTTVWNHHAQAPYLYGDDG 303

  Fly   347 -WVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDDFRGTCGQQPYPLLHEINRV 399
             ||.||:.:|:..|..:.....:||:|::|:.|||..|.||..|||||.:|:::
 Worm   304 IWVSYENQQSILAKMAFARKLQVGGVMVFSIGSDDVTGKCGHGPYPLLTKISKL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 109/379 (29%)
Glyco_18 31..379 CDD:214753 97/357 (27%)
CBM_14 424..476 CDD:279884
cht-4NP_497437.2 GH18_chitinase-like 30..357 CDD:385673 105/364 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.