Sequence 1: | NP_611542.2 | Gene: | Cht8 / 37390 | FlyBaseID: | FBgn0034580 | Length: | 476 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496035.1 | Gene: | chil-27 / 188616 | WormBaseID: | WBGene00011848 | Length: | 407 | Species: | Caenorhabditis elegans |
Alignment Length: | 238 | Identity: | 52/238 - (21%) |
---|---|---|---|
Similarity: | 102/238 - (42%) | Gaps: | 53/238 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 DAYLDLEENSGRGNIKSFNALKLKNPV----LKTLVAVGGWNEGSKRFSLVARDPSKREKFVDDV 138
Fly 139 VRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGLE--PFGFILSAAVGSAQFSAE 201
Fly 202 ISYDIPAMVPYLDLINVMAYDLH-GPWDQVVGINAPLYAAEKDASDSSGRQQQLNVDAVVKYW-- 263
Fly 264 -------------------LKAGAPAEKLILGVPFY--GRSFT 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cht8 | NP_611542.2 | GH18_chitolectin_chitotriosidase | 31..400 | CDD:119351 | 52/238 (22%) |
Glyco_18 | 31..379 | CDD:214753 | 52/238 (22%) | ||
CBM_14 | 424..476 | CDD:279884 | |||
chil-27 | NP_496035.1 | Glyco_hydro_18 | 89..>228 | CDD:279094 | 30/125 (24%) |
GH18_chitinase-like | 97..>235 | CDD:299167 | 31/132 (23%) | ||
Glyco_hydro_18 | 261..>402 | CDD:279094 | 14/69 (20%) | ||
GH18_chitinase-like | 268..>407 | CDD:299167 | 14/62 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1289629at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |