DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and chil-27

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_496035.1 Gene:chil-27 / 188616 WormBaseID:WBGene00011848 Length:407 Species:Caenorhabditis elegans


Alignment Length:238 Identity:52/238 - (21%)
Similarity:102/238 - (42%) Gaps:53/238 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DAYLDLEENSGRGNIKSFNALKLKNPV----LKTLVAVGGWNEGSKRFSLVARDPSKREKFVDDV 138
            |..::::.:|     ::|:.||.|:.:    .|.|:::|| ...::...||..||.::.:|...:
 Worm   114 DGSVEVDHSS-----RTFSKLKEKSKIESSHFKKLLSIGG-RSNTQFLPLVIADPRRKRRFFKSI 172

  Fly   139 VRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGLE--PFGFILSAAVGSAQFSAE 201
            :..|:.:..||:||.|::      ..|.:......||.|||:.|:  ...::||..:...:.|:.
 Worm   173 ISILEEYQLDGVDLLWKW------AKNSNTKKCSRFLCELKQKLKERKKNYVLSVQILPDEPSSW 231

  Fly   202 ISYDIPAMVPYLDLINVMAYDLH-GPWDQVVGINAPLYAAEKDASDSSGRQQQLNVDAVVKYW-- 263
            ..::.....|    :|:...|.: ||..:||      ..::.:...:....::|.|| :.|:.  
 Worm   232 ELFNPANGSP----LNIQVEDCNTGPDTEVV------EPSDSELESTENNSKKLTVD-IFKFCYI 285

  Fly   264 -------------------LKAGAPAEKLILGVPFY--GRSFT 285
                               ||..|.:|.|.|.:.|.  ||:.|
 Worm   286 TSDGNLQFEDEIAMKLFLKLKEQARSENLKLELIFKIDGRTNT 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 52/238 (22%)
Glyco_18 31..379 CDD:214753 52/238 (22%)
CBM_14 424..476 CDD:279884
chil-27NP_496035.1 Glyco_hydro_18 89..>228 CDD:279094 30/125 (24%)
GH18_chitinase-like 97..>235 CDD:299167 31/132 (23%)
Glyco_hydro_18 261..>402 CDD:279094 14/69 (20%)
GH18_chitinase-like 268..>407 CDD:299167 14/62 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.