DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and R09D1.14

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_496028.1 Gene:R09D1.14 / 187741 WormBaseID:WBGene00011170 Length:150 Species:Caenorhabditis elegans


Alignment Length:92 Identity:31/92 - (33%)
Similarity:51/92 - (55%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 THLIYAFLGIEETGQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGGWNEGSKRFSL 123
            ||.::||:.|...|||: ||.  ||.:|.....|:   ..|.:.|.:|.::::|| |:.|..|..
 Worm    66 THAVFAFVNITSDGQLQ-IDG--DLAKNRFTNLIE---IAKQQTPQVKVMISIGG-NDNSNNFKP 123

  Fly   124 VARDPSKREKFVDDVVRFLQRHGFDGL 150
            |...|.:::.|::..|.|||.:..||:
 Worm   124 VLSSPDRKKLFINSTVSFLQTYDIDGV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 31/92 (34%)
Glyco_18 31..379 CDD:214753 31/92 (34%)
CBM_14 424..476 CDD:279884
R09D1.14NP_496028.1 Glyco_18 44..>150 CDD:214753 30/90 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164327
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.