DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and chil-18

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_496024.2 Gene:chil-18 / 187735 WormBaseID:WBGene00011161 Length:429 Species:Caenorhabditis elegans


Alignment Length:409 Identity:96/409 - (23%)
Similarity:171/409 - (41%) Gaps:81/409 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLGVILMAASSSAQG-----NS--------SKNVVCYQGTW---SVYRPGLGKFGMEDIDPFLC 58
            |.:..:|...|..::|     ||        .|.||.|...|   .:.|..|||.          
 Worm    37 LFVFALLALVSIGSEGVPQLRNSRDLTKSPCKKRVVGYYSEWEGTEITRSQLGKL---------- 91

  Fly    59 THLIYAFLGIEETGQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGGWNEGSKRFSL 123
            ||.::||:.::..|:|:       .:.|......|...|:|..|...|.::::|| :..|:.|..
 Worm    92 THAVFAFIHMDSEGKLQ-------FKTNQKERFEKLKTAVKNANSDTKVMISIGG-DHNSENFGS 148

  Fly   124 VARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGLEPF--G 186
            |..|..|:..|:|.:.||:::|...|:|:.|::.|...:    :..::.:|||:|||.|:..  .
 Worm   149 VLSDSEKKSMFIDSIARFIRQHKIHGVDIYWKWLGNSET----EHHDFPSFLKDLKEKLKTVRDD 209

  Fly   187 FILSAAVGSAQFS-AEISYDIPAMVPYLDLINVMAYDLHGPWDQ----VVGINAPLYAAEKDASD 246
            .|:|.....|:.. ....|.....:.|:|.:||.:.|.:|||..    ..|.:||||.       
 Worm   210 SIISIVAPQAKMDRRHDGYKFDDFMEYIDFVNVFSMDYYGPWPNQWGTPTGPSAPLYG------- 267

  Fly   247 SSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGR----------SFTLATAEGNQPGAPHIGK 301
            ..|.::..|||:.:||:........|..:.:|||.|          |.|......:......:|.
 Worm   268 GIGVKKHFNVDSTMKYYTCMTEDPSKFNMVIPFYVRLWKNVKEPISSGTEVFRRADLKNGAAVGN 332

  Fly   302 GIAGNYSREPGVLGYNELCEMMEREEW---TQKWEATQQVPYAYRQR--QWVGYEDPRSLALKAQ 361
            .....::              ::.|.|   ...|:...:.||.:.|.  .::.:|:.:|:..|..
 Worm   333 SYMSRWT--------------VDHEGWELTPALWDDVTKTPYVWNQETGNFLTFENKKSIEAKLA 383

  Fly   362 YVMDNHLGGIMIWSLESDD 380
            |.::::|||:.|..::.|:
 Worm   384 YAIEHNLGGVWIHLVDKDN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 89/375 (24%)
Glyco_18 31..379 CDD:214753 88/372 (24%)
CBM_14 424..476 CDD:279884
chil-18NP_496024.2 Glyco_18 70..401 CDD:214753 88/373 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.