DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and chil-17

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_496019.1 Gene:chil-17 / 187733 WormBaseID:WBGene00011159 Length:435 Species:Caenorhabditis elegans


Alignment Length:420 Identity:102/420 - (24%)
Similarity:180/420 - (42%) Gaps:90/420 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSGLVKLLLGVILMAASSSA-----QGNSSKNVV-----CYQ---GTWSVY------RPGLGKFG 49
            :||:. |..|::..|.::..     :...|||.|     |.:   |.:|.|      :..|.|. 
 Worm    36 ISGIF-LFCGIVSYALTTFVFHFYKEDKFSKNEVGLDPICKRRIVGYYSEYDSTDISKNQLAKL- 98

  Fly    50 MEDIDPFLCTHLIYAFLGIEETGQLRVIDAYLDLEENSGRGNIKSFNALKLK----NPVLKTLVA 110
                     ||.::||:.|:..|.|:..:...:          :.|.:||.|    :..||.:.:
 Worm    99 ---------THAVFAFVDIKYDGTLQFKNLITE----------QKFFSLKSKARSLHSNLKLMFS 144

  Fly   111 VGGWNEGSKRFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFL 175
            :|| :|.|..||....:...:...:..::.|:..|..||:||.|::|..|      |:|||.|.:
 Worm   145 IGG-DENSFDFSSALANTQMKSTLITSIIAFIHSHMIDGVDLHWKWPTSR------DKSNYATLI 202

  Fly   176 KELKEGLEPFG--FILSAAVGSAQFSA-EISYDIPAMVPYLDLINVMAYDLHGP----WDQVVGI 233
            :|::|.::...  .|:|..:.....|. |..:|:.|:..::|.|||.:.|...|    |....|.
 Worm   203 REIREKVDELDAKIIISITIPPVGVSDWESGFDLDAIQKHVDFINVHSMDYAKPLPNQWGTPTGP 267

  Fly   234 NAPLYAAEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPGAPH 298
            :|.:       :.:.|.:|..|||..:|::.........:.|.:|||.|.:            .:
 Worm   268 SASM-------NFNIGLRQHYNVDWTMKHYTCELKKPSMINLVIPFYVRMW------------KN 313

  Fly   299 IGKGIAGNYS-------REPGVLGYNELCE-MMEREEW---TQKWEATQQVPYA--YRQRQWVGY 350
            :.|.|.....       ::..|.|.::|.. .:|.|:.   .:.|:...|.||.  .:.|.:..|
 Worm   314 VQKAIDNRTEVFRNVELKDNEVEGRSQLSRYTVEHEDMELSPESWDNATQTPYVLDLKTRTFFTY 378

  Fly   351 EDPRSLALKAQYVMDNHLGGIMIWSLESDD 380
            |:.:|:.:|..||....|||:.|||::.||
 Worm   379 ENEKSIKVKLDYVNKMDLGGVWIWSVDMDD 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 94/388 (24%)
Glyco_18 31..379 CDD:214753 92/385 (24%)
CBM_14 424..476 CDD:279884
chil-17NP_496019.1 Glyco_18 77..407 CDD:214753 90/375 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164335
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.