DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and K08F9.3

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001263897.1 Gene:K08F9.3 / 187168 WormBaseID:WBGene00010686 Length:287 Species:Caenorhabditis elegans


Alignment Length:166 Identity:30/166 - (18%)
Similarity:67/166 - (40%) Gaps:36/166 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 THLIYAFLGIEETGQLRVIDAYLDLEENSGRGN--IKSFNALKLKNPVLKTLVAVGGWNEGSKRF 121
            ||.::....:.|.|..          |||.:..  ::....|...|...|.::|: |:|:||.: 
 Worm   145 THAVFTSEFVNENGSF----------ENSHKEQEFLECRKKLGESNSTAKIMIAM-GFNKGSCK- 197

  Fly   122 SLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGLEPFG 186
                         :|.:..|::::..||::|.|.:        ||...:.:...:.||..|:...
 Worm   198 -------------IDCITSFIEKYQVDGVELHWNH--------NEHFLSQLETTRNLKNRLKKIS 241

  Fly   187 FILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYD 222
            ......|.::...:.:: ::..::...|.:|:..:|
 Worm   242 NSKLLGVSASSNWSRVT-ELDQVLEVADFVNIELHD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 30/166 (18%)
Glyco_18 31..379 CDD:214753 30/166 (18%)
CBM_14 424..476 CDD:279884
K08F9.3NP_001263897.1 Glyco_hydro_18 122..>272 CDD:279094 28/160 (18%)
GH18_chitinase-like 124..276 CDD:299167 29/164 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.