DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and chil-3

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_496128.1 Gene:chil-3 / 182432 WormBaseID:WBGene00007467 Length:447 Species:Caenorhabditis elegans


Alignment Length:360 Identity:77/360 - (21%)
Similarity:145/360 - (40%) Gaps:96/360 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LCTHLIYAFLGIEETGQLRVIDAYLDLEENSGRGNIKSFNALKLK----NPVLKTLVAVGGWNEG 117
            :.||:||.|  ...|..:..:|         |....:.|..::.|    :..:|.:::||| ::.
 Worm   120 MVTHIIYLF--ARPTNGVMTLD---------GERTRRKFQEMRSKAREVSSTVKVMISVGG-HDH 172

  Fly   118 SKRFSLVARDPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGL 182
            |..||.:..:.:.|..|:..:|.|::....||:::.|.:|..|      |.:||..|:::|:...
 Worm   173 SGAFSAIMSNEASRSVFIKSIVSFVKNEDIDGIEIFWMWPKHR------DVNNYSIFIQDLRNEF 231

  Fly   183 EPF--------GFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGPWDQVVGINAPLYA 239
            ...        .:|:|..|....:   .|:|....:.::|..|:.:....   ::.||.::|||.
 Worm   232 TELQKRTNRKNEYIISLLVPKKSY---WSFDFEDFLKFVDFFNIYSTQFR---EKQVGPDSPLYG 290

  Fly   240 AEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPGAPHIGKGIA 304
            .|       ||    |:|..:||:                        |.:..||...:|.....
 Worm   291 GE-------GR----NIDETMKYY------------------------TCKTGQPSKFNIFVSFH 320

  Fly   305 GNYSREPGVLGYNELCEMME-------------REEWTQKWEATQQVPYAYRQRQ---WV----- 348
            |.:.::..:...|:..::.:             ||...|||. .:.:.:....:.   |:     
 Worm   321 GTFWKDAELPLRNDFDDIFKDKNLTKGAFAVRWRELLQQKWN-LEDIKFHNLTKTSYIWIPGPPT 384

  Fly   349 ---GYEDPRSLALKAQYVMDNHLGGIMIWSLESDD 380
               ..||.|||..|.:||.|.::|||.:|:::.||
 Worm   385 WFMTLEDKRSLREKTKYVADYNIGGITMWTIDQDD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 77/360 (21%)
Glyco_18 31..379 CDD:214753 75/357 (21%)
CBM_14 424..476 CDD:279884
chil-3NP_496128.1 Glyco_18 100..418 CDD:214753 75/357 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164317
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.