DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht8 and CTBS

DIOPT Version :9

Sequence 1:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_004379.1 Gene:CTBS / 1486 HGNCID:2496 Length:385 Species:Homo sapiens


Alignment Length:300 Identity:60/300 - (20%)
Similarity:107/300 - (35%) Gaps:94/300 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DPSKREKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGLEPFGFILSA 191
            ||:.|..::...:...:....||:::|.|.  :.:.|..|    |......:||..:.|    ..
Human   115 DPAFRASWIAQKLNLAKTQYMDGINIDIEQ--EVNCLSPE----YDALTALVKETTDSF----HR 169

  Fly   192 AVGSAQFSAEIS----------YDIPAMVPYLDLINVMAYDLHGP-WDQ-VVGINAPLYAAEKDA 244
            .:..:|.:.:::          |:...:....|.:.||:||.... |.: :...|||........
Human   170 EIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGY 234

  Fly   245 SDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQ---------PGAP--- 297
            :|                ::|.....:||::|||:||..:|......:.         .|||   
Human   235 ND----------------YIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAPCSD 283

  Fly   298 -------------HIGKGIAGNYSREPGVLGYNELCEMMEREEWTQKWEATQQVPYAYRQRQWVG 349
                         .|...|:||.                        |:..|:.|| |..:...|
Human   284 AAGRQVPYKTIMKQINSSISGNL------------------------WDKDQRAPY-YNYKDPAG 323

  Fly   350 ------YEDPRSLALKAQYVMDNHLGGIMIWSLESDDFRG 383
                  |::|:|::|||.|:.:..|.||.:|:....|:.|
Human   324 HFHQVWYDNPQSISLKATYIQNYRLRGIGMWNANCLDYSG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 59/299 (20%)
Glyco_18 31..379 CDD:214753 58/294 (20%)
CBM_14 424..476 CDD:279884
CTBSNP_004379.1 GH18_chitobiase 39..378 CDD:119354 59/299 (20%)
Glyco_18 <115..358 CDD:214753 58/293 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.