DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA4 and RpL37-2

DIOPT Version :10

Sequence 1:NP_002224.1 Gene:KCNA4 / 3739 HGNCID:6222 Length:653 Species:Homo sapiens
Sequence 2:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster


Alignment Length:38 Identity:12/38 - (31%)
Similarity:15/38 - (39%) Gaps:11/38 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   453 RIFKLSRHSKG-----------LQILGHTLRASMRELG 479
            |.|..||.:||           |:.|....|..:||.|
  Fly    45 RSFNWSRKAKGRKAQGTGRMRYLKNLRRRFRNGLREGG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA4NP_002224.1 K_channel_TID 1..>37 CDD:429748
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..148
BTB_POZ 176..303 CDD:453885
Ion_trans 306..570 CDD:459842 12/38 (32%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 462..475 5/23 (22%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 524..529
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 629..653
PDZ-binding. /evidence=ECO:0000250|UniProtKB:P15385 651..653
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 12/38 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.