DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA4 and CG1688

DIOPT Version :10

Sequence 1:NP_002224.1 Gene:KCNA4 / 3739 HGNCID:6222 Length:653 Species:Homo sapiens
Sequence 2:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster


Alignment Length:142 Identity:30/142 - (21%)
Similarity:57/142 - (40%) Gaps:23/142 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   510 SIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGV----LTIALPVPVIVSNFNYFYHR- 569
            |..:|..::|..:||:|:|.:.|.|..||:.....|:.||    :.::....::.......|.| 
  Fly   192 SFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRL 256

Human   570 ---ETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQG 631
               ...::|..:.:....|.|            |.||:...:.:..:.....:.:.|   :.||.
  Fly   257 CCQLQRHQEHRRKSTPGTSTP------------SASSAANSREKDTDKRSKRRMANC---KGCQY 306

Human   632 KGDDSETDKNNC 643
            ...:|||..|:|
  Fly   307 DAANSETSLNDC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA4NP_002224.1 K_channel_TID 1..>37 CDD:429748
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..148
BTB_POZ 176..303 CDD:453885
Ion_trans 306..570 CDD:459842 16/67 (24%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 462..475
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 524..529 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 629..653 7/15 (47%)
PDZ-binding. /evidence=ECO:0000250|UniProtKB:P15385 651..653
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 14/54 (26%)
Ion_trans_2 822..896 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.