DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL54 and AT3G01740

DIOPT Version :9

Sequence 1:NP_611541.1 Gene:mRpL54 / 37389 FlyBaseID:FBgn0034579 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_566150.1 Gene:AT3G01740 / 821088 AraportID:AT3G01740 Length:126 Species:Arabidopsis thaliana


Alignment Length:114 Identity:39/114 - (34%)
Similarity:51/114 - (44%) Gaps:31/114 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AAPAGKKKKLGKLGPIMEKKVIPVETDANKLV--NYVCGSNYMKTGEDIKIKPDSEYPDWLWTL- 93
            ||.|.|.||.||.|...:   .|..:...|.:  ..|.|:|.:|.|.|.||.|||:||||||.| 
plant    21 AAAASKAKKGGKGGGASD---APKGSSLTKEIKSTTVVGANTLKDGSDPKILPDSDYPDWLWHLL 82

  Fly    94 ------------NTEGIVPLDELDPNSKQYWRRLRKL----ALRRNNQL 126
                        |.| .:|.|:|        :|..||    .::.||.:
plant    83 DKRPALSELRRKNVE-TLPYDDL--------KRFVKLDTRGKIKENNSI 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL54NP_611541.1 Ribosomal_L37 66..>93 CDD:285730 17/26 (65%)
AT3G01740NP_566150.1 Ribosomal_L37 43..123 CDD:400738 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4694
eggNOG 1 0.900 - - E1_KOG3435
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538612at2759
OrthoFinder 1 1.000 - - FOG0003494
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104091
Panther 1 1.100 - - LDO PTHR28595
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3389
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.870

Return to query results.
Submit another query.