DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL54 and Mrpl54

DIOPT Version :9

Sequence 1:NP_611541.1 Gene:mRpL54 / 37389 FlyBaseID:FBgn0034579 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_079593.1 Gene:Mrpl54 / 66047 MGIID:1913297 Length:135 Species:Mus musculus


Alignment Length:128 Identity:49/128 - (38%)
Similarity:64/128 - (50%) Gaps:25/128 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WARF------------------YAAKPAAPAGKKKKLGKLGPIMEKKVIP-VETDANKLVNYVCG 68
            |||:                  ||.||..      |.||.|...|....| |.||..:|..:..|
Mouse    13 WARWHPRALPVLRRPGGFSIREYAKKPVG------KGGKGGVAAEALKDPEVCTDPTQLTTHAMG 71

  Fly    69 SNYMKTGEDIKIKPDSEYPDWLWTLNTEGIVPLDELDPNSKQYWRRLRKLALRRNNQLSKLKK 131
            .|..|.|:|:.:|.|||||.||:.:|......|:||:|.|::|||.|||..:.|:|:|||.||
Mouse    72 VNIYKEGQDVALKADSEYPTWLFQVNLGPPKKLEELEPESREYWRLLRKQNIWRHNRLSKNKK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL54NP_611541.1 Ribosomal_L37 66..>93 CDD:285730 13/26 (50%)
Mrpl54NP_079593.1 Ribosomal_L37 67..130 CDD:285730 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833030
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3435
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5213
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003494
OrthoInspector 1 1.000 - - oto95188
orthoMCL 1 0.900 - - OOG6_104091
Panther 1 1.100 - - LDO PTHR28595
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3501
SonicParanoid 1 1.000 - - X3389
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.