DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL54 and Mrpl54

DIOPT Version :9

Sequence 1:NP_611541.1 Gene:mRpL54 / 37389 FlyBaseID:FBgn0034579 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001100240.1 Gene:Mrpl54 / 299628 RGDID:1305694 Length:135 Species:Rattus norvegicus


Alignment Length:122 Identity:47/122 - (38%)
Similarity:67/122 - (54%) Gaps:13/122 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WARFYAAK---PAAPA-------GKK--KKLGKLGPIMEKKVIP-VETDANKLVNYVCGSNYMKT 74
            |||::...   |..|.       .||  .|.||.|...|....| |.||.::|..:..|.|..|.
  Rat    13 WARWHPRALPVPGRPGELFIREYAKKAVSKGGKGGVAAEALKDPEVCTDPSQLTTHAMGVNIYKE 77

  Fly    75 GEDIKIKPDSEYPDWLWTLNTEGIVPLDELDPNSKQYWRRLRKLALRRNNQLSKLKK 131
            |:::.:|||||||.||:.::......|::|:|.|::|||.|||..:.|:|:|||.||
  Rat    78 GQEVALKPDSEYPTWLFQVDLGPPKKLEDLEPESREYWRLLRKQNIWRHNRLSKNKK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL54NP_611541.1 Ribosomal_L37 66..>93 CDD:285730 13/26 (50%)
Mrpl54NP_001100240.1 Ribosomal_L37 67..130 CDD:285730 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336608
Domainoid 1 1.000 46 1.000 Domainoid score I11838
eggNOG 1 0.900 - - E1_KOG3435
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5178
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538612at2759
OrthoFinder 1 1.000 - - FOG0003494
OrthoInspector 1 1.000 - - oto98679
orthoMCL 1 0.900 - - OOG6_104091
Panther 1 1.100 - - LDO PTHR28595
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3389
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.