DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL54 and mrpl37

DIOPT Version :9

Sequence 1:NP_611541.1 Gene:mRpL54 / 37389 FlyBaseID:FBgn0034579 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_588118.1 Gene:mrpl37 / 2539589 PomBaseID:SPCC645.09 Length:139 Species:Schizosaccharomyces pombe


Alignment Length:54 Identity:24/54 - (44%)
Similarity:29/54 - (53%) Gaps:7/54 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GEDIKIKPDSEYPDWLWTLNTEGIVPLDELDPNSKQYWRRLRKLALRRNNQLSK 128
            |.|...:.|.|||:|||:|       |||..||||......||.|:|..|.|:|
pombe    92 GVDPVAREDHEYPEWLWSL-------LDEPAPNSKTARSHARKSAIRAANFLTK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL54NP_611541.1 Ribosomal_L37 66..>93 CDD:285730 9/17 (53%)
mrpl37NP_588118.1 Ribosomal_L37 75..136 CDD:285730 22/50 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3435
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003494
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104091
Panther 1 1.100 - - LDO PTHR28595
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.