DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL54 and mrpl37

DIOPT Version :10

Sequence 1:NP_611541.1 Gene:mRpL54 / 37389 FlyBaseID:FBgn0034579 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_588118.1 Gene:mrpl37 / 2539589 PomBaseID:SPCC645.09 Length:139 Species:Schizosaccharomyces pombe


Alignment Length:54 Identity:24/54 - (44%)
Similarity:29/54 - (53%) Gaps:7/54 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GEDIKIKPDSEYPDWLWTLNTEGIVPLDELDPNSKQYWRRLRKLALRRNNQLSK 128
            |.|...:.|.|||:|||:|       |||..||||......||.|:|..|.|:|
pombe    92 GVDPVAREDHEYPEWLWSL-------LDEPAPNSKTARSHARKSAIRAANFLTK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL54NP_611541.1 Ribosomal_L37 66..>93 CDD:430074 9/17 (53%)
mrpl37NP_588118.1 Ribosomal_L37 75..136 CDD:430074 22/50 (44%)

Return to query results.
Submit another query.