DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL54 and mrpl-54

DIOPT Version :9

Sequence 1:NP_611541.1 Gene:mRpL54 / 37389 FlyBaseID:FBgn0034579 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_492455.1 Gene:mrpl-54 / 172741 WormBaseID:WBGene00009128 Length:133 Species:Caenorhabditis elegans


Alignment Length:112 Identity:44/112 - (39%)
Similarity:57/112 - (50%) Gaps:13/112 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RFYAAKPAAPAGKKKKLGKLGPIMEKKVIPVETDANKLVNYVCGSNYMKTGE-DIKIKPDSEYPD 88
            |.||...||.|....|:.|..         ||.||.||..:||.:.|.:..| ..||.||||||:
 Worm    19 RLYAPPKAAAAAAGVKVDKSF---------VEEDAVKLATHVCINAYTQGDEPGPKILPDSEYPE 74

  Fly    89 WLWTLNTEGIVPLDELDPNSK--QYWRRLRKLALRRNNQLSKLK-KF 132
            ||:.|:......|::||....  .|||.|||..:.:|.::.||| ||
 Worm    75 WLFKLDLRAPRDLEDLDAEKDGWLYWRALRKRQVEQNQRIQKLKTKF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL54NP_611541.1 Ribosomal_L37 66..>93 CDD:285730 14/27 (52%)
mrpl-54NP_492455.1 Ribosomal_L37 40..115 CDD:285730 31/74 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157404
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3435
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I4009
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538612at2759
OrthoFinder 1 1.000 - - FOG0003494
OrthoInspector 1 1.000 - - oto20591
orthoMCL 1 0.900 - - OOG6_104091
Panther 1 1.100 - - LDO PTHR28595
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3501
SonicParanoid 1 1.000 - - X3389
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.