DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL54 and MRPL54

DIOPT Version :9

Sequence 1:NP_611541.1 Gene:mRpL54 / 37389 FlyBaseID:FBgn0034579 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_758455.1 Gene:MRPL54 / 116541 HGNCID:16685 Length:138 Species:Homo sapiens


Alignment Length:121 Identity:51/121 - (42%)
Similarity:69/121 - (57%) Gaps:8/121 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIAPAIGN--WARFYAAKPAAPAGKKKKLGKLGPIMEK--KVIPVETDANKLVNYVCGSNYMKTG 75
            |:.||...  .||.||.||.....|..|    |.:..:  |...|.||..:|..|..|.|..|.|
Human    21 LLNPATSGRLLARDYAKKPVMKGAKSGK----GAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEG 81

  Fly    76 EDIKIKPDSEYPDWLWTLNTEGIVPLDELDPNSKQYWRRLRKLALRRNNQLSKLKK 131
            :|:.:|||:|||:||:.:|......|:||||.|::|||||||..:.|:|:|||.|:
Human    82 QDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL54NP_611541.1 Ribosomal_L37 66..>93 CDD:285730 13/26 (50%)
MRPL54NP_758455.1 Ribosomal_L37 74..133 CDD:400738 29/58 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3435
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5141
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538612at2759
OrthoFinder 1 1.000 - - FOG0003494
OrthoInspector 1 1.000 - - oto91606
orthoMCL 1 0.900 - - OOG6_104091
Panther 1 1.100 - - LDO PTHR28595
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3501
SonicParanoid 1 1.000 - - X3389
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.