DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL54 and MRPL54

DIOPT Version :10

Sequence 1:NP_611541.1 Gene:mRpL54 / 37389 FlyBaseID:FBgn0034579 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_758455.1 Gene:MRPL54 / 116541 HGNCID:16685 Length:138 Species:Homo sapiens


Alignment Length:121 Identity:51/121 - (42%)
Similarity:69/121 - (57%) Gaps:8/121 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIAPAIGN--WARFYAAKPAAPAGKKKKLGKLGPIMEK--KVIPVETDANKLVNYVCGSNYMKTG 75
            |:.||...  .||.||.||.....|..|    |.:..:  |...|.||..:|..|..|.|..|.|
Human    21 LLNPATSGRLLARDYAKKPVMKGAKSGK----GAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEG 81

  Fly    76 EDIKIKPDSEYPDWLWTLNTEGIVPLDELDPNSKQYWRRLRKLALRRNNQLSKLKK 131
            :|:.:|||:|||:||:.:|......|:||||.|::|||||||..:.|:|:|||.|:
Human    82 QDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL54NP_611541.1 Ribosomal_L37 66..>93 CDD:430074 13/26 (50%)
MRPL54NP_758455.1 Ribosomal_L37 74..133 CDD:430074 29/58 (50%)

Return to query results.
Submit another query.