DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL54 and mrpl54

DIOPT Version :9

Sequence 1:NP_611541.1 Gene:mRpL54 / 37389 FlyBaseID:FBgn0034579 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_002941437.1 Gene:mrpl54 / 100494879 XenbaseID:XB-GENE-1009204 Length:122 Species:Xenopus tropicalis


Alignment Length:120 Identity:48/120 - (40%)
Similarity:64/120 - (53%) Gaps:14/120 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIAPAIGNWARFYAAKPAAPA---GKKKKLGKLGPIMEKKVIPVETDANKLVNYVCGSNYMKTGE 76
            |:.||.   .|.||.||...:   |..|::.|...:....||        |..:..|:|..|||.
 Frog    13 LVRPAS---VRTYAKKPVVKSKGKGAVKEVLKGPELCRDPVI--------LTTHAVGANIFKTGP 66

  Fly    77 DIKIKPDSEYPDWLWTLNTEGIVPLDELDPNSKQYWRRLRKLALRRNNQLSKLKK 131
            |:|:|.|||||:||:.|.......|:||.|.:.||||.|||:.:.|||:|.|.||
 Frog    67 DVKLKEDSEYPEWLFHLELGPPKKLEELSPETPQYWRLLRKMHIWRNNRLDKTKK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL54NP_611541.1 Ribosomal_L37 66..>93 CDD:285730 15/26 (58%)
mrpl54XP_002941437.1 Ribosomal_L37 54..116 CDD:369953 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5071
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538612at2759
OrthoFinder 1 1.000 - - FOG0003494
OrthoInspector 1 1.000 - - oto105370
Panther 1 1.100 - - LDO PTHR28595
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3389
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.