DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpa and CAPZA3

DIOPT Version :9

Sequence 1:NP_611539.1 Gene:cpa / 37387 FlyBaseID:FBgn0034577 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_201585.1 Gene:CAPZA3 / 93661 HGNCID:24205 Length:299 Species:Homo sapiens


Alignment Length:280 Identity:92/280 - (32%)
Similarity:156/280 - (55%) Gaps:10/280 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQTPITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASHAFAQYNKDQLTPVRI 65
            |..:.::..:|.|::...:|.||||||...|:|:..|::::.|:......|..|:.:....|:.|
Human     1 MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCI 65

  Fly    66 EGTDHNAIISEHNDLGNGRFYDPRTKQAFKYDHLRKEASDYQD---VEADATAEPWRAALDLETL 127
            :|  :..::|.||.:|:.||:|.::|.:||||.|:.:..|.|.   ::.:  ||..|..|.....
Human    66 DG--NPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQNQLKDIQSHGIIQNE--AEYLRVVLLCALK 126

  Fly   128 AYTASHYRHGVSSVFGKAQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQAGSGTAELKGVL 192
            .|...||..|..::..|...::..|..|||||.::....|||.|:|:|  .||......::.|.:
Human   127 LYVNDHYPKGNCNMLRKTVKSKEYLIACIEDHNYETGECWNGLWKSKW--IFQVNPFLTQVTGRI 189

  Fly   193 KVQVHYYEDGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQLAISENYQTMSDTTF-K 256
            .||.|::...|:.:..||:.:||:.:.|:.|:|....||:|:.||::|.|:.|..|.:|:... |
Human   190 FVQAHFFRCVNLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRK 254

  Fly   257 AMRRQLPITRTKIDWSKIVS 276
            .:||.||:|||.|||.:|:|
Human   255 ILRRDLPVTRTLIDWHRILS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpaNP_611539.1 F-actin_cap_A 15..284 CDD:396017 89/266 (33%)
CAPZA3NP_201585.1 F-actin_cap_A 12..274 CDD:279591 89/267 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0836
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1085166at2759
OrthoFinder 1 1.000 - - FOG0001352
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10653
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.