DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpa and capza2

DIOPT Version :9

Sequence 1:NP_611539.1 Gene:cpa / 37387 FlyBaseID:FBgn0034577 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001017254.1 Gene:capza2 / 550008 XenbaseID:XB-GENE-489168 Length:286 Species:Xenopus tropicalis


Alignment Length:284 Identity:177/284 - (62%)
Similarity:220/284 - (77%) Gaps:3/284 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQTPITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASHAFAQYNKDQLTPVRI 65
            ||: .::|.||||:.:.||:|||||||||||||||.||.||.||::||:|||||||.||.|||:|
 Frog     4 MEE-QLSDEEKVRVAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKI 67

  Fly    66 EGTDHNAIISEHNDLGNGRFYDPRTKQAFKYDHLRKEASDYQDVEADATAEPWRAALDLETLAYT 130
            :|.|...:|:||.|||||||.||::|.:||:|||||||||.:..:.:...|.||..:|....:|.
 Frog    68 DGYDEQVLITEHGDLGNGRFLDPKSKISFKFDHLRKEASDPRPSDGENAIESWRNTVDTAVRSYV 132

  Fly   131 ASHYRHGVSSVFGKAQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQAGSGTAELKGVLKVQ 195
            ..||.:||.:|:||....|.|:..|||.||||.||:|||||||:|..|..  ..|.::.|:||:|
 Frog   133 KEHYPNGVCTVYGKTIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTIT--PSTTKVFGILKIQ 195

  Fly   196 VHYYEDGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQLAISENYQTMSDTTFKAMRR 260
            |||||||||||||.|:..||:.||||.|.|||.|:::||||||||.||||||||||||||||:||
 Frog   196 VHYYEDGNVQLVSHKDIEESLTVSNEVQTAKEFIKIVEDAENEYQTAISENYQTMSDTTFKALRR 260

  Fly   261 QLPITRTKIDWSKIVSYSIGKELK 284
            |||:|||||||:||:||.||||::
 Frog   261 QLPVTRTKIDWNKILSYKIGKEMQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpaNP_611539.1 F-actin_cap_A 15..284 CDD:396017 170/268 (63%)
capza2NP_001017254.1 F-actin_cap_A 17..283 CDD:366546 169/267 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 369 1.000 Domainoid score I901
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 383 1.000 Inparanoid score I2001
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1085166at2759
OrthoFinder 1 1.000 - - FOG0001352
OrthoInspector 1 1.000 - - otm49289
Panther 1 1.100 - - LDO PTHR10653
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.