DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpa and Capza2

DIOPT Version :9

Sequence 1:NP_611539.1 Gene:cpa / 37387 FlyBaseID:FBgn0034577 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001009180.1 Gene:Capza2 / 493810 RGDID:1549770 Length:286 Species:Rattus norvegicus


Alignment Length:279 Identity:173/279 - (62%)
Similarity:217/279 - (77%) Gaps:2/279 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASHAFAQYNKDQLTPVRIEGTDH 70
            ::|.|||||.:.||:|||||||||||||||.||.||.||::||:|||||||.||.|||:|||.:.
  Rat     8 LSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIEGYED 72

  Fly    71 NAIISEHNDLGNGRFYDPRTKQAFKYDHLRKEASDYQDVEADATAEPWRAALDLETLAYTASHYR 135
            ..:|:||.|||||:|.||:.:..||:|||||||:|.:..||:...|.||.:::....||...||.
  Rat    73 QVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPYEAENAIESWRTSVETALRAYVKEHYP 137

  Fly   136 HGVSSVFGKAQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQAGSGTAELKGVLKVQVHYYE 200
            :||.:|:||....|.|:..|||.||||.||:|||||||:|  .|.....|.::.|:||:||||||
  Rat   138 NGVCTVYGKKVDGQQTIIACIESHQFQAKNFWNGRWRSEW--KFTVTPSTTQVVGILKIQVHYYE 200

  Fly   201 DGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQLAISENYQTMSDTTFKAMRRQLPIT 265
            ||||||||.|:.::|:.||||.|.|||.|:::|.||||||.||||||||||||||||:|||||:|
  Rat   201 DGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENYQTMSDTTFKALRRQLPVT 265

  Fly   266 RTKIDWSKIVSYSIGKELK 284
            ||||||:||:||.||||::
  Rat   266 RTKIDWNKILSYKIGKEMQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpaNP_611539.1 F-actin_cap_A 15..284 CDD:396017 167/268 (62%)
Capza2NP_001009180.1 F-actin_cap_A 17..283 CDD:396017 166/267 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340095
Domainoid 1 1.000 363 1.000 Domainoid score I913
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 375 1.000 Inparanoid score I2028
OMA 1 1.010 - - QHG54328
OrthoDB 1 1.010 - - D1085166at2759
OrthoFinder 1 1.000 - - FOG0001352
OrthoInspector 1 1.000 - - otm46208
orthoMCL 1 0.900 - - OOG6_102492
Panther 1 1.100 - - LDO PTHR10653
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X840
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.