DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpa and Capza3

DIOPT Version :9

Sequence 1:NP_611539.1 Gene:cpa / 37387 FlyBaseID:FBgn0034577 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_058860.2 Gene:Capza3 / 29324 RGDID:2271 Length:299 Species:Rattus norvegicus


Alignment Length:279 Identity:91/279 - (32%)
Similarity:156/279 - (55%) Gaps:8/279 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQTPITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASHAFAQYNKDQLTPVRI 65
            |..:.::..:|.:::...::.||||||...|:|:..|::::.|:......|..|:.:....|:.|
  Rat     1 MSLSVLSRQDKEKVIHRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYCVPLCI 65

  Fly    66 EGTDHNAIISEHNDLGNGRFYDPRTKQAFKYDHLRKEASDYQD--VEADATAEPWRAALDLETLA 128
            :|  :..::|.||.:|:.||:|.::|.:|::|.|:.:..|.|.  :..:.| |..|:.:......
  Rat    66 DG--NPVLLSHHNVMGDFRFFDYQSKLSFRFDLLQNQLRDIQSHGIIRNET-EYLRSVVMCALKL 127

  Fly   129 YTASHYRHGVSSVFGKAQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQAGSGTAELKGVLK 193
            |...||.:|..:|..|...|:..|..|||||.:.....|||.|:|:|  .||......::.|.:.
  Rat   128 YVNDHYPNGNCNVLRKTVKNKEFLIACIEDHSYDNGECWNGLWKSKW--IFQVNPFLTQVTGRIF 190

  Fly   194 VQVHYYEDGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQLAISENYQTMSDTTF-KA 257
            ||.||:...|:.:..||:.:||:.|.|:.|:|....||:|:.||::|.|:.|..|.:|:... |.
  Rat   191 VQAHYFRCVNLHVEVSKDLKESLEVVNQAQLALSFARLVEEQENKFQAAVIEELQELSNEALRKI 255

  Fly   258 MRRQLPITRTKIDWSKIVS 276
            :||.||:|||.|||.:|:|
  Rat   256 LRRDLPVTRTLIDWQRILS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpaNP_611539.1 F-actin_cap_A 15..284 CDD:396017 89/265 (34%)
Capza3NP_058860.2 F-actin_cap_A 15..274 CDD:396017 88/263 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0836
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1085166at2759
OrthoFinder 1 1.000 - - FOG0001352
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10653
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.