DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpa and acp1

DIOPT Version :9

Sequence 1:NP_611539.1 Gene:cpa / 37387 FlyBaseID:FBgn0034577 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_594639.1 Gene:acp1 / 2542679 PomBaseID:SPAC12B10.07 Length:256 Species:Schizosaccharomyces pombe


Alignment Length:258 Identity:76/258 - (29%)
Similarity:130/258 - (50%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ILHAPPGEFNEVFNDVRELLKNDTLLKDGASHAFAQYNKDQLTPVRIEGTDHNAIISEHNDLGNG 83
            |..:||||.|:|.:|:|::..:|   ::........|::|..:.|.| ..|...|||..|.|...
pombe    10 IRESPPGEVNQVVHDIRDIGLSD---EEAIHEQLKLYHEDYNSSVSI-SDDEKVIISADNRLEGN 70

  Fly    84 RFYDPRTKQAFKYDHLRKEASDYQDVEADATAEPWRAALDLETLAYTASHYRHGVSSVFGKAQGN 148
            |:||...:::|..::...||.:.:|. .:|...|......::.:|  :.||...|:....|....
pombe    71 RYYDQVLQKSFTINYETMEAENVEDY-TEAIKIPDEIVKQIKKVA--SDHYLSDVTFGIIKKSDE 132

  Fly   149 QITLTICIEDHQFQPKNYWNGRWR--SQWHVTFQAGSGTAELKGVLKVQVHYYEDGNVQLVSSKE 211
            ..:.||.:...::.|||||||.||  ..::|:      ..:|:|...::|||||||||.|.:|:.
pombe   133 VESFTIVLVSSKYNPKNYWNGSWRCICNYNVS------EKKLEGRSHIRVHYYEDGNVWLDASRP 191

  Fly   212 CRESVVVSNEQQVAKEVIRLIEDAENEYQLAISENYQTMSDTTFKAMRRQLPITRTKIDWSKI 274
                  :|...:...::..::...||..|.:.:....:::|..||.:|||||:||.||:|..:
pombe   192 ------ISATVEETSKLYEVLAQVENGIQQSFNVELSSLNDKKFKELRRQLPVTRQKINWENV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpaNP_611539.1 F-actin_cap_A 15..284 CDD:396017 76/258 (29%)
acp1NP_594639.1 F-actin_cap_A 3..253 CDD:279591 76/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 117 1.000 Domainoid score I1498
eggNOG 1 0.900 - - E1_KOG0836
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I1526
OMA 1 1.010 - - QHG54328
OrthoFinder 1 1.000 - - FOG0001352
OrthoInspector 1 1.000 - - oto101937
orthoMCL 1 0.900 - - OOG6_102492
Panther 1 1.100 - - LDO PTHR10653
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R166
SonicParanoid 1 1.000 - - X840
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.