DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shg and ft

DIOPT Version :9

Sequence 1:NP_476722.1 Gene:shg / 37386 FlyBaseID:FBgn0003391 Length:1507 Species:Drosophila melanogaster
Sequence 2:NP_477497.1 Gene:ft / 33627 FlyBaseID:FBgn0001075 Length:5147 Species:Drosophila melanogaster


Alignment Length:1482 Identity:366/1482 - (24%)
Similarity:584/1482 - (39%) Gaps:319/1482 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AGHLNPAQQQTHQQHKRKCRDLGRRLIPARLLLGVIVAISLLSPALALHSP-----PDKNFSGDN 82
            ||||:..||..:                   :|.|:.:    ..|....:|     .|:|   ||
  Fly  2971 AGHLDREQQDEY-------------------ILKVVAS----DGAWRAETPITITIQDQN---DN 3009

  Fly    83 RKPAFKNCAGYAPKVKEEQPENTYVLTVEAVDPD---PDQVIRYSIVQSPFERPKFFINPSTGVI 144
             .|.|:: :.|:....|.|.....|..:.|.|.|   |:.||.||: |.|  .|.|.|:|:||.:
  Fly  3010 -APEFEH-SFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSL-QQP--SPMFSIDPATGEV 3069

  Fly   145 FTTHT--FDRDEPIH--EKFVFVTVQATDNGLPPLDDVCTFNVTIEDINDNAPAFNKARYDESMS 205
            |:...  |...:.:.  |....:||.|||||.|||...|..|:.|.|.::|.|.|.:|.|...:.
  Fly  3070 FSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLP 3134

  Fly   206 ENAQPDAVVMTISASDFDDGNNSLVEYEILRERDFQYFKIDKESGIIYLKRPIDKRPGQSYAIIV 270
            ::|.....::.:.|:|..|...:.::|.::.......|.:.:..|.|.|.:||...|...|.::|
  Fly  3135 QDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVV 3199

  Fly   271 RAYNVVPD---PPQDAQIEVRIRVVESSIKPPSF-VNPIDTPIYLKENLKNFTHPI-ATLRAVSN 330
            ||    .|   |||..:..|.|.|...::..|.| ||...  :.:.||     .|: :|:     
  Fly  3200 RA----TDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQ--VIVPEN-----EPVGSTI----- 3248

  Fly   331 MPDKPEVIFELNTGRTEQTNSKNTFVFNQI--GNEVT----------ISLGKTLDYEAITDYTLT 383
                      |..|.|:.....|..:...|  |||..          |.:.:.|||:.|.:|.|.
  Fly  3249 ----------LTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLN 3303

  Fly   384 MIVRNT--HELGTEHQIKIQVEDVNDNIPYYTEVKSGT-ILENEPPGTPVMQVRAFDMDGTSANN 445
            :.|::.  |.|.:...:.|.:.|||||.|.:...:... |.||:|.||.|.|..|.|.| :..|.
  Fly  3304 ITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKD-SPKNA 3367

  Fly   446 IVSFEL---ADNREYFTIDPNTGNITALTTFDREERDFYNVKVIASDNSPSSLFDNGEPNRGHQV 507
            |:.:..   ..:|.:|.::.:.|.|::..:||.|||..|.:::.|. |..||:       ..:..
  Fly  3368 IIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAK-NPDSSM-------ESYAN 3424

  Fly   508 FRISIGDKNDHKPHFQQDKYLAERLLEDANTNTEVIEVKAEDEDNA--SQILYSIESGNVGDAFK 570
            ..:.:...|:..|.|.|..:..: :.|.:...|.|..|:|.|:|:.  .::.|.:...:....|:
  Fly  3425 LYVHVLGVNEFYPQFLQPVFHFD-VSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFR 3488

  Fly   571 IGLKTGKITVNQKLDYETITEYELKVRA-----FDGIYDDYTTVVIKIEDVNDNPPVFKQDYSVT 630
            |...||.|.|.:.||.||.....|.|.|     ..|...|...|:|.|:|.||.|...|..|:.|
  Fly  3489 IDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTST 3553

  Fly   631 ILEETTYDDCILTVEAYDPDIKDRNADQHIVYS-IHQNDGNRWTID-NSGCLRLVKTLDRDPPNG 693
            |.|.......:.||:|.|.|::.:|  ....|| |:.|....:.|| .:|.:.....|||:..: 
  Fly  3554 ISEAAPVGTKVTTVKAIDKDVRTQN--NQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETS- 3615

  Fly   694 HKNWQVLIKAND-----EDGVGTTVSTVKEVTVTLKDINDNAP-FLINEMPVYWQENRNPG-HVV 751
              .:.::|.|.|     :.|..|       |.:.|:|:|||.| |....:..|..||...| .::
  Fly  3616 --TYNLVIGAIDTGLPPQTGSAT-------VHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIM 3671

  Fly   752 QLQANDYDDTPGAGNFTFGIDSEATPDIKTKFSMD--GDYLHANVQFDREAQKEYFIPIRISDSG 814
            .|.|:|.|.....|.||:.:.....   |:..|:|  ...:.:...||||........|.:.|||
  Fly  3672 TLIASDPDLPRNGGPFTYQLIGGKH---KSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSG 3733

  Fly   815 VPRQSAVSILHLVIGDVNDNAMSEGSSRIFIYNYKGEAPETDIGRVFVDDL--DDWDLEDKYFEW 877
            .|:|.:..:|.:.:.|.|||..:..|..|.:..:.|:.|    ..|.:.|:  :|.|:...|   
  Fly  3734 KPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLP----SNVKLADVRPNDIDIVGDY--- 3791

  Fly   878 KDLPHDQFRLNPSTGMITMLVHTAEGEYDLSFVVTEDSMFV-----PRH-SVDAYVTVVVRELPE 936
                ..:.:.||:...:.:.:..|......|......|:|.     .:| .|.:.|:|..:....
  Fly  3792 ----RCRLQKNPAQSQLQLAIPRACDLITTSHTTPIASVFSYTGNDGKHGDVSSKVSVAFQSFNN 3852

  Fly   937 EAVDKSGSIRFINVTKEEFISVPRDFQSPDALSLKDRLQLSLAKLFNTSVSNVD---VFTVLQ-- 996
            |.:..|.||...|:|...|::   :...|....:|.|:            ||.|   ::::|:  
  Fly  3853 ETLANSVSIMVRNMTAYHFLA---NHYRPILEMIKSRM------------SNEDEVILYSLLEGG 3902

  Fly   997 NENHT-----LDVRF--SAHGSPYYAPEKLNGIVAQNQQRLENELDLQMLMVNIDECLIEKFKCE 1054
            :.|.|     :.||.  :::..|.|..|:|     :.::...:||..:.::|..:.| .|...||
  Fly  3903 SGNSTNLQLLMAVRLAKTSYQQPKYLIERL-----REKRSAFSELLQKEVIVGYEPC-SEPDVCE 3961

  Fly  1055 E----SCTNEL---HKSSV---PYMIYSN-----------TTSFVG--------------VNAFV 1084
            .    |.|..|   |...:   |.::.|.           |:.|.|              .::.|
  Fly  3962 NGGVCSATMRLLDAHSFVIQDSPALVLSGPRVVHDYSCQCTSGFSGEQCSRRQDPCLPNPCHSQV 4026

  Fly  1085 QA-------QCVCEAP--------------LMRRCLNGGSPRY---GENDVCDCIDGFTGPHCEL 1125
            |.       ||:|.|.              ..:.|.||||.:.   |.:..|.|..||.|..||.
  Fly  4027 QCRRLGSDFQCMCPANRDGKHCEKERSDVCYSKPCRNGGSCQRSPDGSSYFCLCRPGFRGNQCES 4091

  Fly  1126 VS------VAFYGSGYAFYEPIAACNNT----------------KISLEITPQID---QGLIMYL 1165
            ||      ...:|......:|...||.|                .:|....|.:|   ..:.:..
  Fly  4092 VSDSCRPNPCLHGGLCVSLKPGYKCNCTPGRYGRHCERFSYGFQPLSYMTFPALDVTTNDISIVF 4156

  Fly  1166 GPLNFNPLLAI---------SDFLALELDNGYPVLTVDYGSGAIRIRHQHI------------KM 1209
            .....|.||..         |||||:||.:|    ...:.||..|.....:            |:
  Fly  4157 ATTKPNSLLLYNYGMQSGGRSDFLAIELVHG----RAYFSSGGARTAISTVIAGRNLADGGWHKV 4217

  Fly  1210 VADRTYQLDIILQRTSIEMTVDN------CRLSTCQTLGAPIGPNEFLNVN-APLQLGG----TP 1263
            .|.|..:    :...|:....|:      |...........:||...||.| .||.:||    .|
  Fly  4218 TATRNGR----VMSLSVAKCADSGDVCTECLPGDSSCYADEVGPVGTLNFNKQPLMIGGLSSADP 4278

  Fly  1264 VDLEQLGRQLNWTHVPNQKGFFGCIRNLTINEQTYNLGMPSVFRNIDSGCQQ 1315
            : ||:.|:       .:.....||:.::.|..:..||.:|...:.|.:||.:
  Fly  4279 I-LERPGQ-------VHSDDLVGCLHSVHIGGRALNLSLPLQQKGILAGCNR 4322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shgNP_476722.1 Cadherin_repeat 93..191 CDD:206637 37/104 (36%)
Cadherin_repeat 200..292 CDD:206637 23/94 (24%)
CA 332..410 CDD:214520 24/91 (26%)
Cadherin_repeat 417..518 CDD:206637 28/104 (27%)
Cadherin_repeat 531..619 CDD:206637 28/94 (30%)
Cadherin_repeat 627..729 CDD:206637 29/108 (27%)
Cadherin_repeat 736..834 CDD:206637 27/100 (27%)
LamG 1127..1294 CDD:238058 44/223 (20%)
Cadherin_C 1358..1489 CDD:279398
ftNP_477497.1 Cadherin_repeat 71..152 CDD:206637
Cadherin_repeat 163..266 CDD:206637
Cadherin_repeat 275..378 CDD:206637
Cadherin_repeat 393..490 CDD:206637
Cadherin_repeat 498..594 CDD:206637
Cadherin_repeat 603..704 CDD:206637
Cadherin_repeat 735..814 CDD:206637
Cadherin 843..>907 CDD:278457
Cadherin 950..1026 CDD:278457
Cadherin_repeat 1053..1149 CDD:206637
Cadherin_repeat 1157..1274 CDD:206637
Cadherin_repeat 1282..1380 CDD:206637
Cadherin_repeat 1390..1485 CDD:206637
Cadherin_repeat 1497..1597 CDD:206637
Cadherin_repeat 1621..1699 CDD:206637
Cadherin_repeat 1720..1818 CDD:206637
Cadherin_repeat 1827..1918 CDD:206637
Cadherin_repeat 1926..2023 CDD:206637
Cadherin_repeat 2031..2162 CDD:206637
Cadherin_repeat 2172..2274 CDD:206637
Cadherin_repeat 2282..2380 CDD:206637
Cadherin_repeat 2388..2487 CDD:206637
Cadherin_repeat 2495..2592 CDD:206637
Cadherin_repeat 2600..2694 CDD:206637
Cadherin_repeat 2710..2806 CDD:206637
Cadherin_repeat 2814..2909 CDD:206637
Cadherin_repeat 2917..3009 CDD:206637 12/63 (19%)
Cadherin 3018..3114 CDD:278457 35/98 (36%)
Cadherin 3129..3220 CDD:278457 23/94 (24%)
Cadherin_repeat 3233..3330 CDD:206637 26/118 (22%)
Cadherin_repeat 3338..3434 CDD:206637 27/104 (26%)
Cadherin_repeat 3443..3541 CDD:206637 27/98 (28%)
Cadherin_repeat 3550..3647 CDD:206637 29/108 (27%)
Cadherin_repeat 3657..3753 CDD:206637 27/98 (28%)
EGF 4017..4047 CDD:278437 6/29 (21%)
EGF_CA 4056..4090 CDD:238011 11/33 (33%)
EGF_CA 4094..4128 CDD:238011 5/33 (15%)
Laminin_G_1 4156..4306 CDD:278483 36/165 (22%)
LamG 4428..4543 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.