DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.7 and AT5G55510

DIOPT Version :10

Sequence 1:NP_611538.1 Gene:ND-B14.7 / 37385 FlyBaseID:FBgn0034576 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_200362.3 Gene:AT5G55510 / 835645 AraportID:AT5G55510 Length:214 Species:Arabidopsis thaliana


Alignment Length:87 Identity:25/87 - (28%)
Similarity:34/87 - (39%) Gaps:23/87 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LSKPQGYLPTL---GRFAYNTGPLMGMATAFTLTTLVATNARGKDDKINYLIGGFAAGGVFGAWK 104
            |.|.:|:..:.   |:.|.....|.|:   .:|...:....|||||.||  :|            
plant    71 LFKKKGFKGSFVDAGQSAKTFAVLSGV---HSLVVCLLKQIRGKDDAIN--VG------------ 118

  Fly   105 HNHVAGLCAGLFLGIAGVIKKM 126
               |||.|.||.|...|..:.|
plant   119 ---VAGCCTGLALSFPGAPQAM 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.7NP_611538.1 None
AT5G55510NP_200362.3 Tim17 47..146 CDD:460567 25/87 (29%)

Return to query results.
Submit another query.