DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.7 and OEP16-3

DIOPT Version :10

Sequence 1:NP_611538.1 Gene:ND-B14.7 / 37385 FlyBaseID:FBgn0034576 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001031527.1 Gene:OEP16-3 / 818821 AraportID:AT2G42210 Length:173 Species:Arabidopsis thaliana


Alignment Length:170 Identity:40/170 - (23%)
Similarity:57/170 - (33%) Gaps:56/170 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KYYDHPDGE---------------DAFGKIVATNKYA--VSAGVAWSMFDVLTLSKPQGYLPTLG 54
            :|.:..||.               ..:|.|:||.|..  |...||               ||.|.
plant    21 RYLEEEDGPLMKTIKGSITGFGAGTIYGTILATWKDVPRVERNVA---------------LPGLI 70

  Fly    55 R-----------FAYNTGPLMGMATAFTLTTLVATNARGKDDKINYLIGGFAAG-GVFGAWKHNH 107
            |           ||...|..:|:..       :..|.|.|.|..|..||||.|| .|.|....:.
plant    71 RTLKMMGTHGLTFAAIGGVYIGVEQ-------LVQNFRSKRDFYNGAIGGFVAGASVLGYRARSI 128

  Fly   108 VAGLCAGLFLGIAGVI-----KKMSIEQGWEFFPNTPIKQ 142
            ...:.||..|.:...:     :...::.|.|::|.|..|:
plant   129 PTAIAAGATLAVTSALIDSGGQTTRVDNGREYYPYTVEKR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.7NP_611538.1 None
OEP16-3NP_001031527.1 Tim17 30..140 CDD:460567 32/131 (24%)

Return to query results.
Submit another query.